2024-04-20 18:59:54, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001177326 1228 bp mRNA linear ROD 19-MAR-2023 DEFINITION Rattus norvegicus homeobox C8 (Hoxc8), mRNA. ACCESSION NM_001177326 VERSION NM_001177326.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1228) AUTHORS Vermot J, Schuhbaur B, Le Mouellic H, McCaffery P, Garnier JM, Hentsch D, Brulet P, Niederreither K, Chambon P, Dolle P and Le Roux I. TITLE Retinaldehyde dehydrogenase 2 and Hoxc8 are required in the murine brachial spinal cord for the specification of Lim1+ motoneurons and the correct distribution of Islet1+ motoneurons JOURNAL Development 132 (7), 1611-1621 (2005) PUBMED 15753214 REFERENCE 2 (bases 1 to 1228) AUTHORS Bayarsaihan D, Bitchevaia N, Enkhmandakh B, Tussie-Luna MI, Leckman JF, Roy A and Ruddle F. TITLE Expression of BEN, a member of TFII-I family of transcription factors, during mouse pre- and postimplantation development JOURNAL Gene Expr Patterns 3 (5), 579-589 (2003) PUBMED 12971990 REFERENCE 3 (bases 1 to 1228) AUTHORS Nauta AJ, Daha MR, Tijsma O, van de Water B, Tedesco F and Roos A. TITLE The membrane attack complex of complement induces caspase activation and apoptosis JOURNAL Eur J Immunol 32 (3), 783-792 (2002) PUBMED 11870622 REFERENCE 4 (bases 1 to 1228) AUTHORS van den Akker E, Fromental-Ramain C, de Graaff W, Le Mouellic H, Brulet P, Chambon P and Deschamps J. TITLE Axial skeletal patterning in mice lacking all paralogous group 8 Hox genes JOURNAL Development 128 (10), 1911-1921 (2001) PUBMED 11311170 REFERENCE 5 (bases 1 to 1228) AUTHORS Schnabel CA and Abate-Shen C. TITLE Repression by HoxA7 is mediated by the homeodomain and the modulatory action of its N-terminal-arm residues JOURNAL Mol Cell Biol 16 (6), 2678-2688 (1996) PUBMED 8649375 REFERENCE 6 (bases 1 to 1228) AUTHORS Sakoyama Y, Mizuta I, Ogasawara N and Yoshikawa H. TITLE Cloning of rat homeobox genes JOURNAL Biochem Genet 32 (9-10), 351-360 (1994) PUBMED 7702549 REFERENCE 7 (bases 1 to 1228) AUTHORS Pellerin I, Schnabel C, Catron KM and Abate C. TITLE Hox proteins have different affinities for a consensus DNA site that correlate with the positions of their genes on the hox cluster JOURNAL Mol Cell Biol 14 (7), 4532-4545 (1994) PUBMED 7911971 REFERENCE 8 (bases 1 to 1228) AUTHORS Chung SY, Dai PH, Lei J, Riviere M, Levan G, Szpirer J and Szpirer C. TITLE Chromosomal assignment of seven rat homeobox genes to rat chromosomes 3, 4, 7, and 10 JOURNAL Mamm Genome 4 (9), 537-540 (1993) PUBMED 7906969 REFERENCE 9 (bases 1 to 1228) AUTHORS Falzon M and Chung SY. TITLE The expression of rat homeobox-containing genes is developmentally regulated and tissue specific JOURNAL Development 103 (3), 601-610 (1988) PUBMED 2907739 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000187.1. On Oct 20, 2010 this sequence version replaced NM_001177326.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMD00132261, SAMD00132262 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-436 JACYVU010000187.1 20862436-20862871 437-1228 JACYVU010000187.1 20864211-20865002 FEATURES Location/Qualifiers source 1..1228 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="7" /map="7q36" gene 1..1228 /gene="Hoxc8" /gene_synonym="Hox3r4" /note="homeobox C8" /db_xref="GeneID:24460" /db_xref="RGD:2821" CDS 1..729 /gene="Hoxc8" /gene_synonym="Hox3r4" /note="homeobox protein R4; Homeobox gene C8; homeo box C8" /codon_start=1 /product="homeobox protein Hox-C8" /protein_id="NP_001170797.2" /db_xref="GeneID:24460" /db_xref="RGD:2821" /translation="
MSSYFVNPLFSKYKGGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD"
misc_feature order(448..462,466..468,517..519,535..537,574..576, 580..585,592..597,601..609,613..618) /gene="Hoxc8" /gene_synonym="Hox3r4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(454..456,463..465,583..585,592..597,604..606) /gene="Hoxc8" /gene_synonym="Hox3r4" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 457..615 /gene="Hoxc8" /gene_synonym="Hox3r4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 1..436 /gene="Hoxc8" /gene_synonym="Hox3r4" /inference="alignment:Splign:2.1.0" exon 437..1228 /gene="Hoxc8" /gene_synonym="Hox3r4" /inference="alignment:Splign:2.1.0" ORIGIN
atgagctcctacttcgtcaaccccctgttctccaaatacaaaggcggcgagtccctggaaccggcctattacgactgccggttccctcagagcgtgggcagaagccatgcgctggtgtacgggcccggcggctcagcgcccggcttccagcacgcctcgcaccacgtccaagacttcttccaccacggcacctccggcatctccaactcgggctaccagcagaacccgtgctcgctgagctgccacggagacgcctccaaattctatggctacgaggcgctccccagacagtccctttatggggctcagcaagaggcgagcgtggtgcaatatcccgactgtaaatcctccgccaacactaacagtagcgaaggacaaggccacttaaatcagaactcgtctcccagcctcatgtttccatggatgagaccccacgctcctgggcggcgcagcggacgacaaacttacagccggtatcagaccttggaactagagaaggagtttctctttaatccttatttgaccagaaagcgccggattgaagtctctcacgccctgggactgacggaaagacaagtgaagatttggttccagaatcgaaggatgaagtggaaaaaggagaacaacaaggataaacttcctggggcccgagatgaggagaaggtggaagaagaagggaatgaggaagaggagaaggaggaggaggaaaaggaagaaaataaggactaagaaaaaagagaaaatcagccccccccacaactcccttgaagtttcgttttatggtagcagataaattgagaagtttacgactgtcatttgcttttatagagaatagaatgacactcacaactgtaactacctgtcagatagttgcagctctgcttttattacctttggccttcccccactctttatttgtctgggggttgggagggggaacctgagacacagggaaaagttctgttccactccatgcccagcacacactcacttgtccctacttccacttctgagcccttcccgataaagcctaaccctacacacacacacacacacacacacacacacacacacacacacaccacacacacttctctccacactctttacacgattctctggtatttattttaaaagggattcccctgaagatgtagaagatgattcctggctttgcttgtatgctgggaattagaatactggattgacttttttttttaaatgaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]