LOCUS       NM_001113544            1620 bp    mRNA    linear   ROD 19-JUN-2023
DEFINITION  Rattus norvegicus WT1 associated protein (Wtap), transcript variant
            3, mRNA.
ACCESSION   NM_001113544
VERSION     NM_001113544.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1620)
  AUTHORS   Wang H, Fu L, Li Y, Wei L, Gu X, Li H, Li J and Wen S.
  TITLE     m6A methyltransferase WTAP regulates myocardial ischemia
            reperfusion injury through YTHDF1/FOXO3a signaling
  JOURNAL   Apoptosis 28 (5-6), 830-839 (2023)
   PUBMED   36894806
  REMARK    GeneRIF: m6A methyltransferase WTAP regulates myocardial ischemia
            reperfusion injury through YTHDF1/FOXO3a signaling.
REFERENCE   2  (bases 1 to 1620)
  AUTHORS   Du Y, Hou G, Zhang H, Dou J, He J, Guo Y, Li L, Chen R, Wang Y,
            Deng R, Huang J, Jiang B, Xu M, Cheng J, Chen GQ, Zhao X and Yu J.
  TITLE     SUMOylation of the m6A-RNA methyltransferase METTL3 modulates its
            function
  JOURNAL   Nucleic Acids Res 46 (10), 5195-5208 (2018)
   PUBMED   29506078
REFERENCE   3  (bases 1 to 1620)
  AUTHORS   Scholler E, Weichmann F, Treiber T, Ringle S, Treiber N, Flatley A,
            Feederle R, Bruckmann A and Meister G.
  TITLE     Interactions, localization, and phosphorylation of the m6A
            generating METTL3-METTL14-WTAP complex
  JOURNAL   RNA 24 (4), 499-512 (2018)
   PUBMED   29348140
REFERENCE   4  (bases 1 to 1620)
  AUTHORS   Wen J, Lv R, Ma H, Shen H, He C, Wang J, Jiao F, Liu H, Yang P, Tan
            L, Lan F, Shi YG, He C, Shi Y and Diao J.
  TITLE     Zc3h13 Regulates Nuclear RNA m6A Methylation and Mouse Embryonic
            Stem Cell Self-Renewal
  JOURNAL   Mol Cell 69 (6), 1028-1038 (2018)
   PUBMED   29547716
REFERENCE   5  (bases 1 to 1620)
  AUTHORS   Yue Y, Liu J, Cui X, Cao J, Luo G, Zhang Z, Cheng T, Gao M, Shu X,
            Ma H, Wang F, Wang X, Shen B, Wang Y, Feng X, He C and Liu J.
  TITLE     VIRMA mediates preferential m6A mRNA methylation in 3'UTR and near
            stop codon and associates with alternative polyadenylation
  JOURNAL   Cell Discov 4, 10 (2018)
   PUBMED   29507755
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1620)
  AUTHORS   Horiuchi K, Kawamura T, Iwanari H, Ohashi R, Naito M, Kodama T and
            Hamakubo T.
  TITLE     Identification of Wilms' tumor 1-associating protein complex and
            its role in alternative splicing and the cell cycle
  JOURNAL   J Biol Chem 288 (46), 33292-33302 (2013)
   PUBMED   24100041
REFERENCE   7  (bases 1 to 1620)
  AUTHORS   Ahmed F, Torrado M, Zinovieva RD, Senatorov VV, Wistow G and
            Tomarev SI.
  TITLE     Gene expression profile of the rat eye iridocorneal angle: NEIBank
            expressed sequence tag analysis
  JOURNAL   Invest Ophthalmol Vis Sci 45 (9), 3081-3090 (2004)
   PUBMED   15326124
REFERENCE   8  (bases 1 to 1620)
  AUTHORS   Niksic M, Slight J, Sanford JR, Caceres JF and Hastie ND.
  TITLE     The Wilms' tumour protein (WT1) shuttles between nucleus and
            cytoplasm and is present in functional polysomes
  JOURNAL   Hum Mol Genet 13 (4), 463-471 (2004)
   PUBMED   14681305
REFERENCE   9  (bases 1 to 1620)
  AUTHORS   Little NA, Hastie ND and Davies RC.
  TITLE     Identification of WTAP, a novel Wilms' tumour 1-associating protein
  JOURNAL   Hum Mol Genet 9 (15), 2231-2239 (2000)
   PUBMED   11001926
REFERENCE   10 (bases 1 to 1620)
  AUTHORS   Hoja MR, Wahlestedt C and Hoog C.
  TITLE     A visual intracellular classification strategy for uncharacterized
            human proteins
  JOURNAL   Exp Cell Res 259 (1), 239-246 (2000)
   PUBMED   10942595
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CB613959.1, CB613741.1, CX570823.1 and BQ202659.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CB613959.1, EV771027.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132261, SAMD00132262
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-5                 CB613959.1         1-5
            6-559               CB613741.1         1-554
            560-1004            CX570823.1         272-716
            1005-1620           BQ202659.1         1-616               c
FEATURES             Location/Qualifiers
     source          1..1620
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="Sprague-Dawley"
                     /db_xref="taxon:10116"
                     /chromosome="1"
                     /map="1q11"
     gene            1..1620
                     /gene="Wtap"
                     /gene_synonym="RGD1563824"
                     /note="WT1 associated protein"
                     /db_xref="GeneID:499020"
                     /db_xref="RGD:1563824"
     exon            1..119
                     /gene="Wtap"
                     /gene_synonym="RGD1563824"
                     /inference="alignment:Splign:2.1.0"
     exon            120..157
                     /gene="Wtap"
                     /gene_synonym="RGD1563824"
                     /inference="alignment:Splign:2.1.0"
     CDS             128..583
                     /gene="Wtap"
                     /gene_synonym="RGD1563824"
                     /note="isoform b is encoded by transcript variant 3;
                     Wilms' tumour 1-associating protein; pre-mRNA-splicing
                     regulator WTAP; Wilms tumor 1 associated protein"
                     /codon_start=1
                     /product="pre-mRNA-splicing regulator WTAP isoform b"
                     /protein_id="NP_001107016.1"
                     /db_xref="GeneID:499020"
                     /db_xref="RGD:1563824"
                     /translation="

MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDR"

     misc_feature    329..>577
                     /gene="Wtap"
                     /gene_synonym="RGD1563824"
                     /note="WTAP/Mum2p family; Region: Wtap; pfam17098"
                     /db_xref="CDD:407242"
     exon            158..213
                     /gene="Wtap"
                     /gene_synonym="RGD1563824"
                     /inference="alignment:Splign:2.1.0"
     exon            214..272
                     /gene="Wtap"
                     /gene_synonym="RGD1563824"
                     /inference="alignment:Splign:2.1.0"
     exon            273..400
                     /gene="Wtap"
                     /gene_synonym="RGD1563824"
                     /inference="alignment:Splign:2.1.0"
     exon            401..1605
                     /gene="Wtap"
                     /gene_synonym="RGD1563824"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

agacccgcaaataaaggctatctccggggctgcggcgggaggagtgcgggggggggccggcggcggcgcggcctcggcctgtgtgactggcggcgcccgcgcagcctcgggctgggaagggtacaagatgaccaacgaagaacctcttcctaaaaaggtccgactgagtgaaacagacttcaaagttatggcacgggatgagttaattctgagatggaaacaatatgaagcatatgttcaagctttggagggaaagtacacagaccttaattcaaacgatgtgactggcttaagggaatctgaagaaaaactaaagcagcaacagcaggaatctgcacgcagggagaacatccttgtcatgcggctagcaaccaaggaacaggagatgcaagagtgcaccactcaaatccagtacctcaagcaagttcagcagccgagtgtagcccaactgagatcaacaatggtagacccagcgatcaacttgtttttcctaaaaatgaaaggtgaactggaacagactaaagacaaactggaacaagcccaaaatgaactgagtgcctggaagtttacgcctgataggtaaacaaatcatactccccagtcaagacttccctgacagtcccacctcgagaaagctgtggtgggacagccaagtactcgtttccacaccaagactcagactttttgagccaaaaaagccacattcttagactgtccagcttgtaatggttaatgtaaaacttaccagatgaaccttgtgtttcagcttctttctcttcccctcccccttgcttcagaggcctgatgccgtcggactattccgaagaagaggccacctccgaaaaattccccttctaggacatgtagacacttgaaatgtttctgtttgaagaaaatagagggaaaaacagaagtcttaagtctgtggcacactgtgtcttcagacagtttggaggattgaaaacctagaggttttaaatcatgaattgaacatgtaaaattccagtaaaatgtaaaaatggaatatgcatcgctcttaaccatgagcatagtgacttagagacactgtacatcagttatgccaataagactgtggacttcatgattgttgaactactgggtcaaaactcaaatgaggtgaattttgcctttaaaggatttacttgctaagaaccaactctaatagccgtgagactatcacgtcatagctaccagtacaagtagtgcatatatttatccatttagctttgagctctatattacataatggagccttaaatctatgtggtttttatcaatggtttgttttttgaatggttgtggaaactgtagataaccttaaccgaggactgtacaaacgtgaaggtgtggtctcacacttcaggtttaaactgtttgacgcattataagcattcatttcacaactagattgtatatggtatttggctgtgatgagattcccattattcagtaaaccctcatctcattcagcaggcacatgttaaacagcattgtcgttggtgttaaatgggggaatgtgttccttcattgtatttggggccttttgtatcgaattcttgatattaaattaaatgtgccttgaaaaaaaaaaaaaaaaaa

//