GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-04 17:43:34, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001110143            1027 bp    mRNA    linear   ROD 20-MAR-2023
DEFINITION  Rattus norvegicus claudin 22 (Cldn22), mRNA.
ACCESSION   NM_001110143 XM_001059255 XM_224843
VERSION     NM_001110143.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1027)
  AUTHORS   Krause G, Winkler L, Mueller SL, Haseloff RF, Piontek J and Blasig
            IE.
  TITLE     Structure and function of claudins
  JOURNAL   Biochim Biophys Acta 1778 (3), 631-645 (2008)
   PUBMED   18036336
  REMARK    Review article
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000282.1.
            
            On Sep 1, 2022 this sequence version replaced NM_001110143.1.
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1027              JACYVU010000282.1  8224387-8225413     c
FEATURES             Location/Qualifiers
     source          1..1027
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="16"
                     /map="16q11"
     gene            1..1027
                     /gene="Cldn22"
                     /note="claudin 22"
                     /db_xref="GeneID:306454"
                     /db_xref="RGD:1305271"
     exon            1..1027
                     /gene="Cldn22"
                     /inference="alignment:Splign:2.1.0"
     CDS             64..726
                     /gene="Cldn22"
                     /codon_start=1
                     /product="claudin-22"
                     /protein_id="NP_001103613.1"
                     /db_xref="GeneID:306454"
                     /db_xref="RGD:1305271"
                     /translation="
MGLVFRTATQSAALLLSLLGWVLSCLTNYLPHWKNLNLELNEMENWTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQISRILMSLSNGLGLLGLLASGCGLDCLRLGETRKGLKRRLLILGGTLLWTSGVMVLVPVSWVAHMTVQEFWDETVPEIVPRWEFGEALFLGWFAGFCLVLGGCVLHCAACWRPAPPASGHYAVAGLGDHQQHLELKQANPEV"
     misc_feature    <208..612
                     /gene="Cldn22"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      
tcacactttttacagcaagcgtggggcaggagttgggctggctcaggctcacagaacgttctaatgggcttagtcttccgaacggcaactcagtcagctgcactcctgctctctctgctgggatgggttttatcctgcctcacaaactacttgccacactggaagaacctcaacctggagctgaacgagatggaaaactggactatggggctctggaaatcctgcgtcatccaggaggaggtcgggaggcaatgcaaggactttgactccttcctggccttgccagctgaactgcagatctccaggatcctgatgtccctgtccaatgggctggggctgctgggcttgctggcctctggctgtggcctggactgtctgaggctcggagagacccggaagggtctgaagaggcgactgctcatcctgggagggaccctgctctggacctctggtgtgatggtcctggttcctgtctcctgggtggcccacatgacagtgcaagagttctgggatgagactgtacctgagattgtgcccaggtgggagttcggggaggccctgttcctgggctggtttgctggtttctgcctggtgcttggaggatgtgtgcttcactgtgcagcctgctggaggccggctcctccagcctcgggccactatgcagtggcgggactaggagaccaccagcagcatctggagctgaaacaagctaacccagaagtctaagcccgagggatcagtggcatctctgatctcactcagctggacttggtaggctctcctgctataatcacccctactcactgtgcttttgatttctctgaaatgcatacttccctcctgtggctatcatcctcttcaaatacaagttctctctacaaccgggtaaagagcttctacttcctattcggaggccaagtgagtcaggacctatggatggagtctgtcgctactgggcagaagctctgcctcccttttaaagcagactgtgacacagggcaccagtaaataaagcattatctgagca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]