GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-03-29 13:36:57, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001108837            1871 bp    mRNA    linear   ROD 20-MAR-2023
DEFINITION  Rattus norvegicus mesenchyme homeobox 1 (Meox1), mRNA.
ACCESSION   NM_001108837 XM_001081499 XM_343970
VERSION     NM_001108837.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1871)
  AUTHORS   Wu Y, Li YJ, Shi LL, Liu Y, Wang Y, Bao X, Xu W, Yao LY, Mbadhi MN,
            Chen L, Li S, Li XY, Zhang ZF, Zhao S, Zhang RN, Chen SY, Zhang JX
            and Jun-mingTang.
  TITLE     Spatio-temporal model of Meox1 expression control involvement of
            Sca-1-positive stem cells in neointima formation through the
            synergistic effect of Rho/CDC42 and SDF-1alpha/CXCR4
  JOURNAL   Stem Cell Res Ther 12 (1), 387 (2021)
   PUBMED   34233723
  REMARK    GeneRIF: Spatio-temporal model of Meox1 expression control
            involvement of Sca-1-positive stem cells in neointima formation
            through the synergistic effect of Rho/CDC42 and SDF-1alpha/CXCR4.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1871)
  AUTHORS   Wu B, Zhang L, Zhu YH, Zhang YE, Zheng F, Yang JY, Guo LY, Li XY,
            Wang L, Tang JM, Chen SY and Wang JN.
  TITLE     Mesoderm/mesenchyme homeobox gene l promotes vascular smooth muscle
            cell phenotypic modulation and vascular remodeling
  JOURNAL   Int J Cardiol 251, 82-89 (2018)
   PUBMED   29113690
  REMARK    GeneRIF: Meox1 promotes vascular smooth muscle cell phenotypic
            modulation.
REFERENCE   3  (bases 1 to 1871)
  AUTHORS   Douville JM, Cheung DY, Herbert KL, Moffatt T and Wigle JT.
  TITLE     Mechanisms of MEOX1 and MEOX2 regulation of the cyclin dependent
            kinase inhibitors p21 and p16 in vascular endothelial cells
  JOURNAL   PLoS One 6 (12), e29099 (2011)
   PUBMED   22206000
REFERENCE   4  (bases 1 to 1871)
  AUTHORS   Skuntz S, Mankoo B, Nguyen MT, Hustert E, Nakayama A,
            Tournier-Lasserve E, Wright CV, Pachnis V, Bharti K and Arnheiter
            H.
  TITLE     Lack of the mesodermal homeodomain protein MEOX1 disrupts
            sclerotome polarity and leads to a remodeling of the
            cranio-cervical joints of the axial skeleton
  JOURNAL   Dev Biol 332 (2), 383-395 (2009)
   PUBMED   19520072
REFERENCE   5  (bases 1 to 1871)
  AUTHORS   Wissmuller S, Kosian T, Wolf M, Finzsch M and Wegner M.
  TITLE     The high-mobility-group domain of Sox proteins interacts with
            DNA-binding domains of many transcription factors
  JOURNAL   Nucleic Acids Res 34 (6), 1735-1744 (2006)
   PUBMED   16582099
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1871)
  AUTHORS   Rodrigo I, Bovolenta P, Mankoo BS and Imai K.
  TITLE     Meox homeodomain proteins are required for Bapx1 expression in the
            sclerotome and activate its transcription by direct binding to its
            promoter
  JOURNAL   Mol Cell Biol 24 (7), 2757-2766 (2004)
   PUBMED   15024065
REFERENCE   7  (bases 1 to 1871)
  AUTHORS   Mankoo BS, Skuntz S, Harrigan I, Grigorieva E, Candia A, Wright CV,
            Arnheiter H and Pachnis V.
  TITLE     The concerted action of Meox homeobox genes is required upstream of
            genetic pathways essential for the formation, patterning and
            differentiation of somites
  JOURNAL   Development 130 (19), 4655-4664 (2003)
   PUBMED   12925591
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473948.1.
            
            On or before Oct 4, 2007 this sequence version replaced
            XM_343970.3, XM_001081499.1.
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1871
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="10"
                     /map="10q32.1"
     gene            1..1871
                     /gene="Meox1"
                     /note="mesenchyme homeobox 1"
                     /db_xref="GeneID:363684"
                     /db_xref="RGD:1308911"
     CDS             1..762
                     /gene="Meox1"
                     /codon_start=1
                     /product="homeobox protein MOX-1"
                     /protein_id="NP_001102307.1"
                     /db_xref="GeneID:363684"
                     /db_xref="RGD:1308911"
                     /translation="
MDPVVNSCVRNPQPPAPVWGCLRNPHSEGSSASGLPHYPPTPFSFHQKSDFPATAAYPDFSTSCLAATPHSLPRAERIFNEQHPAFPQTPDWHFPISEAGQRLNLGPAGSAREMGAGSPGLVDGTGGLGEDCMVLGTIAHETEKKLSRRKKERSDNPENGGGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPVSPQEQDPEDGDSAASPSSE"
     misc_feature    415..753
                     /gene="Meox1"
                     /note="Homeodomain-containing transcription factor
                     [Transcription]; Region: COG5576"
                     /db_xref="CDD:227863"
     misc_feature    order(511..525,529..531,580..582,598..600,637..639,
                     643..648,655..660,664..672,676..681)
                     /gene="Meox1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(517..519,526..528,646..648,655..660,667..669)
                     /gene="Meox1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    520..678
                     /gene="Meox1"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     exon            1..463
                     /gene="Meox1"
                     /inference="alignment:Splign:2.1.0"
     exon            464..639
                     /gene="Meox1"
                     /inference="alignment:Splign:2.1.0"
     exon            640..1871
                     /gene="Meox1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atggatccggtggtcaacagctgcgtgaggaacccccagcccccagctcccgtctggggctgccttcgaaacccccactcggaaggcagcagcgcctcagggctgccccattacccaccaaccccgttttccttccaccaaaagtccgatttcccagcgacagcagcataccccgacttctctacttcctgcctggcagccaccccacacagcctgccccgcgctgagcgaatcttcaatgagcagcatcctgccttcccacagacccctgactggcatttccccatctctgaagcggggcaaaggctcaacctaggcccagctgggagcgccagagagatgggggctggcagccccggcctggtggacggcacaggaggattgggtgaggactgcatggtgcttgggaccatcgcccatgagacggagaagaaattatccagaaggaaaaaggagaggtcagacaacccagagaatggaggaggaaagccagaaggcagcagcaaggcccggaaggaaaggacagctttcaccaaggagcagctacgggagctagaggctgagttcgcccaccataactacctgaccaggctccgtagatacgagattgcagtcaacctggacctttcagagcggcaggtcaaagtgtggttccagaaccggagaatgaagtggaagcgtgtgaaggggggtcagcccgtgtccccacaggagcaggacccagaggatggagactctgcagcttctccgagttcagagtgagatgctccaaagaccaaaaccaagaaagactgaacgaacgccctttccaactcccaccacccactcccaccctcacatcttctggacccacccaggcagcctgcgcacactcgtacgtagatgtgaagttgcccagtgtgggagccttgaatttcccagaaggtttagcccagcatcgccccagtctcagcagccccttccccagggcttcaattttccacactctcttgaactccacaggacccagcggactgggaaactctagaaacagaacctgggacactcttttctgggtctcttggctgctacccacacctaccatccccctcttacatcaagtctcctctgggtctggccccatatggcctgtgcagaatccattccttggtaccagctggtgacttgtaaaagcaaaaccctctccagatgttcacaccattgcattgagtggaaggctagaaagtggctcctgtctctaaggacggagagactagcacaagagctgatggatgatgacctagacacatggacctcaggctacagcatcctgtgtgctctaaggactctgactgcaaatgaagacaggaaaacagtccatcttcctccatgggatgcatctggacctgtcctgcatgttccccaaagctattttgtgggaagaactcccaggttcacacacatgggcagctcaaatctcagacccaacttctaagaatgccgctgtgaggactggtgggcagacagcctcgggcagcagtatccttggaggagaccccgtatgcctcagtattagatggtggctctcgcaggtcctgctgttgttgcagaaggaggtcagcaagtgtttggatttcttgcatgtagatttgattgccagtgtttaaaaataaccccggttccccaccccaccccatcaagacagaagctgtggaaaatgattgtcaaatgagatggcaagttaaagcatgtatcagtttccccctaaagcatacttcatatggtttttttttctaagattatgtcaaaaaattgtgcaaggtcaattcactttgtaagaaaactctcggagaaataaatcaaccaaaaaaaaaaaaaaaaaaagcagtttc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]