2024-03-29 13:36:57, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001108837 1871 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus mesenchyme homeobox 1 (Meox1), mRNA. ACCESSION NM_001108837 XM_001081499 XM_343970 VERSION NM_001108837.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1871) AUTHORS Wu Y, Li YJ, Shi LL, Liu Y, Wang Y, Bao X, Xu W, Yao LY, Mbadhi MN, Chen L, Li S, Li XY, Zhang ZF, Zhao S, Zhang RN, Chen SY, Zhang JX and Jun-mingTang. TITLE Spatio-temporal model of Meox1 expression control involvement of Sca-1-positive stem cells in neointima formation through the synergistic effect of Rho/CDC42 and SDF-1alpha/CXCR4 JOURNAL Stem Cell Res Ther 12 (1), 387 (2021) PUBMED 34233723 REMARK GeneRIF: Spatio-temporal model of Meox1 expression control involvement of Sca-1-positive stem cells in neointima formation through the synergistic effect of Rho/CDC42 and SDF-1alpha/CXCR4. Publication Status: Online-Only REFERENCE 2 (bases 1 to 1871) AUTHORS Wu B, Zhang L, Zhu YH, Zhang YE, Zheng F, Yang JY, Guo LY, Li XY, Wang L, Tang JM, Chen SY and Wang JN. TITLE Mesoderm/mesenchyme homeobox gene l promotes vascular smooth muscle cell phenotypic modulation and vascular remodeling JOURNAL Int J Cardiol 251, 82-89 (2018) PUBMED 29113690 REMARK GeneRIF: Meox1 promotes vascular smooth muscle cell phenotypic modulation. REFERENCE 3 (bases 1 to 1871) AUTHORS Douville JM, Cheung DY, Herbert KL, Moffatt T and Wigle JT. TITLE Mechanisms of MEOX1 and MEOX2 regulation of the cyclin dependent kinase inhibitors p21 and p16 in vascular endothelial cells JOURNAL PLoS One 6 (12), e29099 (2011) PUBMED 22206000 REFERENCE 4 (bases 1 to 1871) AUTHORS Skuntz S, Mankoo B, Nguyen MT, Hustert E, Nakayama A, Tournier-Lasserve E, Wright CV, Pachnis V, Bharti K and Arnheiter H. TITLE Lack of the mesodermal homeodomain protein MEOX1 disrupts sclerotome polarity and leads to a remodeling of the cranio-cervical joints of the axial skeleton JOURNAL Dev Biol 332 (2), 383-395 (2009) PUBMED 19520072 REFERENCE 5 (bases 1 to 1871) AUTHORS Wissmuller S, Kosian T, Wolf M, Finzsch M and Wegner M. TITLE The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors JOURNAL Nucleic Acids Res 34 (6), 1735-1744 (2006) PUBMED 16582099 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1871) AUTHORS Rodrigo I, Bovolenta P, Mankoo BS and Imai K. TITLE Meox homeodomain proteins are required for Bapx1 expression in the sclerotome and activate its transcription by direct binding to its promoter JOURNAL Mol Cell Biol 24 (7), 2757-2766 (2004) PUBMED 15024065 REFERENCE 7 (bases 1 to 1871) AUTHORS Mankoo BS, Skuntz S, Harrigan I, Grigorieva E, Candia A, Wright CV, Arnheiter H and Pachnis V. TITLE The concerted action of Meox homeobox genes is required upstream of genetic pathways essential for the formation, patterning and differentiation of somites JOURNAL Development 130 (19), 4655-4664 (2003) PUBMED 12925591 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH473948.1. On or before Oct 4, 2007 this sequence version replaced XM_343970.3, XM_001081499.1. ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1871 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="10" /map="10q32.1" gene 1..1871 /gene="Meox1" /note="mesenchyme homeobox 1" /db_xref="GeneID:363684" /db_xref="RGD:1308911" CDS 1..762 /gene="Meox1" /codon_start=1 /product="homeobox protein MOX-1" /protein_id="NP_001102307.1" /db_xref="GeneID:363684" /db_xref="RGD:1308911" /translation="
MDPVVNSCVRNPQPPAPVWGCLRNPHSEGSSASGLPHYPPTPFSFHQKSDFPATAAYPDFSTSCLAATPHSLPRAERIFNEQHPAFPQTPDWHFPISEAGQRLNLGPAGSAREMGAGSPGLVDGTGGLGEDCMVLGTIAHETEKKLSRRKKERSDNPENGGGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPVSPQEQDPEDGDSAASPSSE"
misc_feature 415..753 /gene="Meox1" /note="Homeodomain-containing transcription factor [Transcription]; Region: COG5576" /db_xref="CDD:227863" misc_feature order(511..525,529..531,580..582,598..600,637..639, 643..648,655..660,664..672,676..681) /gene="Meox1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(517..519,526..528,646..648,655..660,667..669) /gene="Meox1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 520..678 /gene="Meox1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 1..463 /gene="Meox1" /inference="alignment:Splign:2.1.0" exon 464..639 /gene="Meox1" /inference="alignment:Splign:2.1.0" exon 640..1871 /gene="Meox1" /inference="alignment:Splign:2.1.0" ORIGIN
atggatccggtggtcaacagctgcgtgaggaacccccagcccccagctcccgtctggggctgccttcgaaacccccactcggaaggcagcagcgcctcagggctgccccattacccaccaaccccgttttccttccaccaaaagtccgatttcccagcgacagcagcataccccgacttctctacttcctgcctggcagccaccccacacagcctgccccgcgctgagcgaatcttcaatgagcagcatcctgccttcccacagacccctgactggcatttccccatctctgaagcggggcaaaggctcaacctaggcccagctgggagcgccagagagatgggggctggcagccccggcctggtggacggcacaggaggattgggtgaggactgcatggtgcttgggaccatcgcccatgagacggagaagaaattatccagaaggaaaaaggagaggtcagacaacccagagaatggaggaggaaagccagaaggcagcagcaaggcccggaaggaaaggacagctttcaccaaggagcagctacgggagctagaggctgagttcgcccaccataactacctgaccaggctccgtagatacgagattgcagtcaacctggacctttcagagcggcaggtcaaagtgtggttccagaaccggagaatgaagtggaagcgtgtgaaggggggtcagcccgtgtccccacaggagcaggacccagaggatggagactctgcagcttctccgagttcagagtgagatgctccaaagaccaaaaccaagaaagactgaacgaacgccctttccaactcccaccacccactcccaccctcacatcttctggacccacccaggcagcctgcgcacactcgtacgtagatgtgaagttgcccagtgtgggagccttgaatttcccagaaggtttagcccagcatcgccccagtctcagcagccccttccccagggcttcaattttccacactctcttgaactccacaggacccagcggactgggaaactctagaaacagaacctgggacactcttttctgggtctcttggctgctacccacacctaccatccccctcttacatcaagtctcctctgggtctggccccatatggcctgtgcagaatccattccttggtaccagctggtgacttgtaaaagcaaaaccctctccagatgttcacaccattgcattgagtggaaggctagaaagtggctcctgtctctaaggacggagagactagcacaagagctgatggatgatgacctagacacatggacctcaggctacagcatcctgtgtgctctaaggactctgactgcaaatgaagacaggaaaacagtccatcttcctccatgggatgcatctggacctgtcctgcatgttccccaaagctattttgtgggaagaactcccaggttcacacacatgggcagctcaaatctcagacccaacttctaagaatgccgctgtgaggactggtgggcagacagcctcgggcagcagtatccttggaggagaccccgtatgcctcagtattagatggtggctctcgcaggtcctgctgttgttgcagaaggaggtcagcaagtgtttggatttcttgcatgtagatttgattgccagtgtttaaaaataaccccggttccccaccccaccccatcaagacagaagctgtggaaaatgattgtcaaatgagatggcaagttaaagcatgtatcagtttccccctaaagcatacttcatatggtttttttttctaagattatgtcaaaaaattgtgcaaggtcaattcactttgtaagaaaactctcggagaaataaatcaaccaaaaaaaaaaaaaaaaaaagcagtttc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]