ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-09-18 20:30:06, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001107094 1848 bp mRNA linear ROD 20-MAR-2023
DEFINITION Rattus norvegicus homeo box D10 (Hoxd10), mRNA.
ACCESSION NM_001107094 XM_001063804 XM_221510
VERSION NM_001107094.1
KEYWORDS RefSeq; RefSeq Select.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 1848)
AUTHORS Ruan Z, Li Y, He R and Li X.
TITLE Inhibition of microRNA-10b-5p up-regulates HOXD10 to attenuate
Alzheimer's disease in rats via the Rho/ROCK signalling pathway
JOURNAL J Drug Target 29 (5), 531-540 (2021)
PUBMED 33307856
REMARK GeneRIF: Inhibition of microRNA-10b-5p up-regulates HOXD10 to
attenuate Alzheimer's disease in rats via the Rho/ROCK signalling
pathway.
REFERENCE 2 (bases 1 to 1848)
AUTHORS Wang R, Huang Q, Zhou R, Dong Z, Qi Y, Li H, Wei X, Wu H, Wang H,
Wilcox CS, Hultstrom M, Zhou X and Lai EY.
TITLE Sympathoexcitation in Rats With Chronic Heart Failure Depends on
Homeobox D10 and MicroRNA-7b Inhibiting GABBR1 Translation in
Paraventricular Nucleus
JOURNAL Circ Heart Fail 9 (1), e002261 (2016)
PUBMED 26699387
REMARK GeneRIF: ANG II/AT1R/HoxD10/miR-7b/GABBR1 pathway in the PVN
contributes to sympathoexcitation and deterioration of cardiac
function in heart failure.
REFERENCE 3 (bases 1 to 1848)
AUTHORS Raines AM, Adam M, Magella B, Meyer SE, Grimes HL, Dey SK and
Potter SS.
TITLE Recombineering-based dissection of flanking and paralogous Hox gene
functions in mouse reproductive tracts
JOURNAL Development 140 (14), 2942-2952 (2013)
PUBMED 23760953
REFERENCE 4 (bases 1 to 1848)
AUTHORS Seki T, Shimokawa N, Iizuka H, Takagishi K and Koibuchi N.
TITLE Abnormalities of vertebral formation and Hox expression in
congenital kyphoscoliotic rats
JOURNAL Mol Cell Biochem 312 (1-2), 193-199 (2008)
PUBMED 18327665
REFERENCE 5 (bases 1 to 1848)
AUTHORS Wu Y, Wang G, Scott SA and Capecchi MR.
TITLE Hoxc10 and Hoxd10 regulate mouse columnar, divisional and motor
pool identity of lumbar motoneurons
JOURNAL Development 135 (1), 171-182 (2008)
PUBMED 18065432
REFERENCE 6 (bases 1 to 1848)
AUTHORS Wellik DM and Capecchi MR.
TITLE Hox10 and Hox11 genes are required to globally pattern the
mammalian skeleton
JOURNAL Science 301 (5631), 363-367 (2003)
PUBMED 12869760
REFERENCE 7 (bases 1 to 1848)
AUTHORS Pan L, Xie Y, Black TA, Jones CA, Pruitt SC and Gross KW.
TITLE An Abd-B class HOX.PBX recognition sequence is required for
expression from the mouse Ren-1c gene
JOURNAL J Biol Chem 276 (35), 32489-32494 (2001)
PUBMED 11432851
REFERENCE 8 (bases 1 to 1848)
AUTHORS de la Cruz CC, Der-Avakian A, Spyropoulos DD, Tieu DD and Carpenter
EM.
TITLE Targeted disruption of Hoxd9 and Hoxd10 alters locomotor behavior,
vertebral identity, and peripheral nervous system development
JOURNAL Dev Biol 216 (2), 595-610 (1999)
PUBMED 10642795
REFERENCE 9 (bases 1 to 1848)
AUTHORS Carpenter EM, Goddard JM, Davis AP, Nguyen TP and Capecchi MR.
TITLE Targeted disruption of Hoxd-10 affects mouse hindlimb development
JOURNAL Development 124 (22), 4505-4514 (1997)
PUBMED 9409668
REFERENCE 10 (bases 1 to 1848)
AUTHORS Zappavigna V, Renucci A, Izpisua-Belmonte JC, Urier G, Peschle C
and Duboule D.
TITLE HOX4 genes encode transcription factors with potential auto- and
cross-regulatory capacities
JOURNAL EMBO J 10 (13), 4177-4187 (1991)
PUBMED 1756725
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from CH473949.1.
On or before Oct 4, 2007 this sequence version replaced
XM_221510.4, XM_001063804.1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
RNAseq introns :: single sample supports all introns SAMEA5760384,
SAMEA5760475 [ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on single protein-coding transcript
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..1848
/organism="Rattus norvegicus"
/mol_type="mRNA"
/db_xref="taxon:10116"
/chromosome="3"
/map="3q23"
gene 1..1848
/gene="Hoxd10"
/note="homeo box D10"
/db_xref="GeneID:303991"
/db_xref="RGD:1306511"
exon 1..845
/gene="Hoxd10"
/inference="alignment:Splign:2.1.0"
CDS 101..1123
/gene="Hoxd10"
/codon_start=1
/product="homeobox protein Hox-D10"
/protein_id="NP_001100564.1"
/db_xref="GeneID:303991"
/db_xref="RGD:1306511"
/translation="
MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTANIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNNPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNETASGQEPTKVSQVESPEAKGGLPEERSCLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS"
misc_feature 899..1069
/gene="Hoxd10"
/note="Region: Homeodomain; pfam00046"
/db_xref="CDD:459649"
exon 846..1848
/gene="Hoxd10"
/inference="alignment:Splign:2.1.0"
ORIGIN
atgtggtcggcagaggcatccacaattacaccgggaatgttttcctagcgatgtcagcctacaaaggacacaatctctcttcttcaaattcctccccaaaatgtcctttcccaacagctctcctgctgctaatacttttttagtagattccttgatcagtgcctgcaggagtgacagtttttattcgagcagcgccagcatgtacatgccaccacctagcgcagacatggggacctatggaatgcaaacctgtggactgctcccgtctctggccaaaagagaagtgaaccaccaaaatatgggtatgaatgtacatccttatatacctcaagtagacagttggacagacccgaacagatcttgtcgaatagagcaacctgttacacagcaagtccccacttgctcattcaccgccaacattaaagaagaatccaattgctgcatgtattctgataagcgcaacaaactcatttctgccgaggtcccttcgtaccagaggctggtccccgagtcttgtcctgttgagaaccccgaggttcctgtccctggatattttagactgagtcagacctacgccaccgggaaaacccaagagtacaataacaaccccgaaggcagctccactgtcatgctccagctcaaccctcgtggcgcggccaagccgcagctctcggctgcccagctgcagatggaaaagaagatgaacgaaaccgcgagcggccaggagcccactaaagtctcccaagtggagagccccgaggccaaaggcggccttccagaagagaggagctgcctggctgaggtctccgtgtccagccccgaagtgcaggagaaggaaagcaaagaggaaatcaagtctgatactccaaccagcaattggctcactgcaaagagtggcagaaagaagaggtgcccttacactaaacaccaaacgctggaattagaaaaagagttcttgttcaatatgtacctcacccgcgagcgccgcctagagatcagtaagagcgttaacctcaccgacaggcaggtcaagatttggtttcaaaaccgccgaatgaaactcaagaagatgagccgagagaatcgaatccgagaactgaccgccaacctcaccttttcttaggtctgaggcccatgtgaggccaggatccgagagggggcaccgagttccaggcccgagtactgaaggactagggaggcggaaacaaaaccttcattgctctttggttgttttgttttgttttgttttgttctgttctgttttcctgctagaatgtgactttggggtcattctgttcgtgctgcaagtgatctgtaatccctacgagtatacatatatatatattaaaaaaacttagcacgtgtaatttattttttcatcgtaatgcagggtaactattactgcgcattttcatttgggtcttaacttattggaactgtagagcatccatctaaccttatccacccagccagccagccagcaatgtgacttttccatgtttttcctaacataaaagttctctctgtgtgtggttagcccatgaactcatgacattttgaaaacatccagtacttaaaaaaaacaacaaaaaaatcctatatctatatatatttcaaaagattaagaaaacccacaagctttgggggggagggggactttaaaagcacattacaatgtatcttttcacaaacgaacttagcaattgtccttggtgaaatggattattgacttatgccttgtagcctttccttgtggtgcatctgtggtttggtagaaatacaagagcaacctgtgcttttttgtgcatgttctggtcgcatgtgtaatgcaataaactctggaaatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]