GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-13 16:54:37, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_001102364            1550 bp    mRNA    linear   ROD 05-MAY-2025
DEFINITION  Rattus norvegicus claudin 6 (Cldn6), transcript variant 1, mRNA.
ACCESSION   NM_001102364 XM_001055688 XM_220202
VERSION     NM_001102364.2
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1550)
  AUTHORS   Harris,H.J., Davis,C., Mullins,J.G., Hu,K., Goodall,M.,
            Farquhar,M.J., Mee,C.J., McCaffrey,K., Young,S., Drummer,H.,
            Balfe,P. and McKeating,J.A.
  TITLE     Claudin association with CD81 defines hepatitis C virus entry
  JOURNAL   J Biol Chem 285 (27), 21092-21102 (2010)
   PUBMED   20375010
REFERENCE   2  (bases 1 to 1550)
  AUTHORS   Krause,G., Winkler,L., Mueller,S.L., Haseloff,R.F., Piontek,J. and
            Blasig,I.E.
  TITLE     Structure and function of claudins
  JOURNAL   Biochim Biophys Acta 1778 (3), 631-645 (2008)
   PUBMED   18036336
  REMARK    Review article
REFERENCE   3  (bases 1 to 1550)
  AUTHORS   Nunes,F.D., Lopez,L.N., Lin,H.W., Davies,C., Azevedo,R.B., Gow,A.
            and Kachar,B.
  TITLE     Distinct subdomain organization and molecular composition of a
            tight junction with adherens junction features
  JOURNAL   J Cell Sci 119 (Pt 23), 4819-4827 (2006)
   PUBMED   17130295
REFERENCE   4  (bases 1 to 1550)
  AUTHORS   Morita,K., Furuse,M., Yoshida,Y., Itoh,M., Sasaki,H., Tsukita,S.
            and Miyachi,Y.
  TITLE     Molecular architecture of tight junctions of periderm differs from
            that of the maculae occludentes of epidermis
  JOURNAL   J Invest Dermatol 118 (6), 1073-1079 (2002)
   PUBMED   12060405
REFERENCE   5  (bases 1 to 1550)
  AUTHORS   Morita,K., Furuse,M., Fujimoto,K. and Tsukita,S.
  TITLE     Claudin multigene family encoding four-transmembrane domain protein
            components of tight junction strands
  JOURNAL   Proc Natl Acad Sci U S A 96 (2), 511-516 (1999)
   PUBMED   9892664
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAXUCZ010000010.1.
            
            On May 5, 2025 this sequence version replaced NM_001102364.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC168250.1, SRR26643287.23725.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760400, SAMEA5760494
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-115               JAXUCZ010000010.1  13215808-13215922
            116-1550            JAXUCZ010000010.1  13217148-13218582
FEATURES             Location/Qualifiers
     source          1..1550
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="10"
                     /map="10q12"
     gene            1..1550
                     /gene="Cldn6"
                     /note="claudin 6"
                     /db_xref="GeneID:287098"
                     /db_xref="RGD:1308837"
     exon            1..115
                     /gene="Cldn6"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    102..104
                     /gene="Cldn6"
                     /note="upstream in-frame stop codon"
     exon            116..1550
                     /gene="Cldn6"
                     /inference="alignment:Splign:2.1.0"
     CDS             132..791
                     /gene="Cldn6"
                     /codon_start=1
                     /product="claudin-6"
                     /protein_id="NP_001095834.1"
                     /db_xref="GeneID:287098"
                     /db_xref="RGD:1308837"
                     /translation="
MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVITLLIVLLGLLLYLAGAKCTTCVEDKNSKSRLVLISGVIFVISGVLTLIPICWTAHAIIQDFYNPLVADAQKRELGASLYLGWAASGLLLIGGGLLCCACSSGGTQGPSHYVARYSSPVPHSRGPSEYPSKNYV"
     misc_feature    141..641
                     /gene="Cldn6"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
ORIGIN      
cccagctctgcgggcgccgccattaagcccctcctggtctcgcactcctaggcttggatatcgtgggtggccgaaccggacaggacgccctcggacaaagctgactgagcatttgccccctcaacctcatcatggcctctactggtctgcaaatcttggggattgtcctgaccctgcttggctgggtcaacgccctggtgtcctgtgccctgccgatgtggaaggtgaccgccttcatcggcaacagcatcgttgtggcccagatggtgtgggaggggctatggatgtcctgtgtggtccagagcactggtcagatgcagtgcaaggtgtacgactcgctgctggcgctgccccaggacctgcaggctgccagagccctctgtgtcatcaccctcctcattgtcctgcttggcctactcctgtaccttgccggagccaagtgcactacctgtgtggaagacaagaattccaagtctcgtctggtgctcatctctggtgtcatcttcgtcatctccggggtcctgaccctcattcccatctgctggactgcccacgccatcatccaggacttctacaaccccttggtcgcagacgctcaaaagcgagagctaggggcctccctctacctgggttgggccgcctcaggccttttgctgataggtggagggctgctatgctgcgcctgctcttctggagggacccagggacccagccattatgtggcccgctattcttcgcctgtcccacattctcggggaccctccgaatacccctccaagaattatgtctgatgcccactggggagtgaggctctactggccagagaacctgagctgagccgtgagaaatgatgtggggtagtttttggggtttgtcttgttccttgttttccttttgcaatgctgggtatgaaacctggggccccgcatatttggtaggcaagcactccacagtgagctgtgtggtaccctgccccctagggttggttccacctgtttttgagacaggctctccctaatggcgctctgactgacctccagctctcgttttttttttttttttgtttgtttgtttttttttcctgtctcaccctgagtccgaactccgcctatcgctccgttactggcatttctcgcttttacctactgtagctggagggatttgaccctgagttcctgtgtctttattcattctggggatctactgtgcaaagtgttttaaggctgcctgtgaatctggcctttgcgattctcaaaatggcttgtcccgagagttcctgctgtggctggaggtaactcacaggacagacacacccgctcctggtcaaactcttcccagtcctggaagggcaggtgataatttacctaagaattttcaactcagtcttccaacctttggcccctgaatcccatcaccaaggttactgtgtactctccccacatacggtcccagctgtgctgtagaccctcctcccccttacctctaaccttgcacatttccctgcccacacaatgttttacttaataaaacatgattttttttttttatat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]