GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-07-04 05:20:14, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001047880            1639 bp    mRNA    linear   ROD 27-APR-2025
DEFINITION  Rattus norvegicus solute carrier family 25 member 15 (Slc25a15),
            mRNA; nuclear gene for mitochondrial product.
ACCESSION   NM_001047880 XM_001064456 XM_001064514 XM_001064627 XM_001064682
            XM_224969
VERSION     NM_001047880.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1639)
  AUTHORS   Da Cruz,S., Xenarios,I., Langridge,J., Vilbois,F., Parone,P.A. and
            Martinou,J.C.
  TITLE     Proteomic analysis of the mouse liver mitochondrial inner membrane
  JOURNAL   J Biol Chem 278 (42), 41566-41571 (2003)
   PUBMED   12865426
REFERENCE   2  (bases 1 to 1639)
  AUTHORS   Fiermonte,G., Dolce,V., David,L., Santorelli,F.M., Dionisi-Vici,C.,
            Palmieri,F. and Walker,J.E.
  TITLE     The mitochondrial ornithine transporter. Bacterial expression,
            reconstitution, functional characterization, and tissue
            distribution of two human isoforms
  JOURNAL   J Biol Chem 278 (35), 32778-32783 (2003)
   PUBMED   12807890
REFERENCE   3  (bases 1 to 1639)
  AUTHORS   Camacho,J.A., Rioseco-Camacho,N., Andrade,D., Porter,J. and Kong,J.
  TITLE     Cloning and characterization of human ORNT2: a second mitochondrial
            ornithine transporter that can rescue a defective ORNT1 in patients
            with the hyperornithinemia-hyperammonemia-homocitrullinuria
            syndrome, a urea cycle disorder
  JOURNAL   Mol Genet Metab 79 (4), 257-271 (2003)
   PUBMED   12948741
REFERENCE   4  (bases 1 to 1639)
  AUTHORS   Morris,S.M. Jr. and Kepka-Lenhart,D.
  TITLE     Hormonal induction of hepatic mitochondrial ornithine/citrulline
            transporter mRNA
  JOURNAL   Biochem Biophys Res Commun 294 (4), 749-752 (2002)
   PUBMED   12061769
  REMARK    GeneRIF: Transcriptional Activation of ORNT1 mRNA by dexamethasone
            in hepatocytes.
REFERENCE   5  (bases 1 to 1639)
  AUTHORS   Tsujino,S., Kanazawa,N., Ohashi,T., Eto,Y., Saito,T., Kira,J. and
            Yamada,T.
  TITLE     Three novel mutations (G27E, insAAC, R179X) in the ORNT1 gene of
            Japanese patients with hyperornithinemia, hyperammonemia, and
            homocitrullinuria syndrome
  JOURNAL   Ann Neurol 47 (5), 625-631 (2000)
   PUBMED   10805333
REFERENCE   6  (bases 1 to 1639)
  AUTHORS   Camacho,J.A., Obie,C., Biery,B., Goodman,B.K., Hu,C.A.,
            Almashanu,S., Steel,G., Casey,R., Lambert,M., Mitchell,G.A. and
            Valle,D.
  TITLE     Hyperornithinaemia-hyperammonaemia-homocitrullinuria syndrome is
            caused by mutations in a gene encoding a mitochondrial ornithine
            transporter
  JOURNAL   Nat Genet 22 (2), 151-158 (1999)
   PUBMED   10369256
REFERENCE   7  (bases 1 to 1639)
  AUTHORS   Indiveri,C., Tonazzi,A., Stipani,I. and Palmieri,F.
  TITLE     The purified and reconstituted ornithine/citrulline carrier from
            rat liver mitochondria: electrical nature and coupling of the
            exchange reaction with H+ translocation
  JOURNAL   Biochem J 327 (Pt 2) (Pt 2), 349-355 (1997)
   PUBMED   9359400
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CA339807.1, AY325139.1 and DY310527.1.
            
            On Jul 1, 2017 this sequence version replaced NM_001047880.2.
            
            ##Evidence-Data-START##
            CDS exon combination :: AY325139.1 [ECO:0000331]
            RNAseq introns       :: partial sample support SAMD00132261,
                                    SAMD00132262 [ECO:0000350]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            gene product(s) localized to mito. :: inferred from homology
            RefSeq Select criteria             :: based on conservation,
                                                  longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-60                CA339807.1         142-201
            61-1078             AY325139.1         41-1058
            1079-1639           DY310527.1         54-614
FEATURES             Location/Qualifiers
     source          1..1639
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="16"
                     /map="16q12.5"
     gene            1..1639
                     /gene="Slc25a15"
                     /gene_synonym="Ab1-114; Ornt1"
                     /note="solute carrier family 25 member 15"
                     /db_xref="GeneID:306574"
                     /db_xref="RGD:1311488"
     exon            1..115
                     /gene="Slc25a15"
                     /gene_synonym="Ab1-114; Ornt1"
                     /inference="alignment:Splign:2.1.0"
     CDS             61..1077
                     /gene="Slc25a15"
                     /gene_synonym="Ab1-114; Ornt1"
                     /note="ornithine transporter) member 15; solute carrier
                     family 25 (mitochondrial carrier; ornithine transporter)
                     member 15"
                     /codon_start=1
                     /product="mitochondrial ornithine transporter 1"
                     /protein_id="NP_001041345.1"
                     /db_xref="GeneID:306574"
                     /db_xref="RGD:1311488"
                     /translation="
MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLRTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVVGLDRQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAASQNTVWSVVKEIFRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPIPLMLSGGFGGICLWLAVYPVDCIKSRIQVLSMTGKQTGLIRTFLSIVKNEGGYRLSESRLYDVSFVQPKTCLSGVHYVGILKLGLREGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMSQLEAC"
     misc_feature    85..342
                     /gene="Slc25a15"
                     /gene_synonym="Ab1-114; Ornt1"
                     /note="Mitochondrial carrier protein; Region: Mito_carr;
                     pfam00153"
                     /db_xref="CDD:395101"
     misc_feature    <424..654
                     /gene="Slc25a15"
                     /gene_synonym="Ab1-114; Ornt1"
                     /note="Mitochondrial carrier protein; Region: Mito_carr;
                     pfam00153"
                     /db_xref="CDD:395101"
     misc_feature    673..1056
                     /gene="Slc25a15"
                     /gene_synonym="Ab1-114; Ornt1"
                     /note="Mitochondrial carrier protein; Region: Mito_carr;
                     pfam00153"
                     /db_xref="CDD:395101"
     exon            116..374
                     /gene="Slc25a15"
                     /gene_synonym="Ab1-114; Ornt1"
                     /inference="alignment:Splign:2.1.0"
     exon            375..512
                     /gene="Slc25a15"
                     /gene_synonym="Ab1-114; Ornt1"
                     /inference="alignment:Splign:2.1.0"
     exon            513..682
                     /gene="Slc25a15"
                     /gene_synonym="Ab1-114; Ornt1"
                     /inference="alignment:Splign:2.1.0"
     exon            683..841
                     /gene="Slc25a15"
                     /gene_synonym="Ab1-114; Ornt1"
                     /inference="alignment:Splign:2.1.0"
     exon            842..952
                     /gene="Slc25a15"
                     /gene_synonym="Ab1-114; Ornt1"
                     /inference="alignment:Splign:2.1.0"
     exon            953..1615
                     /gene="Slc25a15"
                     /gene_synonym="Ab1-114; Ornt1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ggatatgtggttcacatccttccctccagagaattgccttcaacagaaaccagtaacgccatgaagtccaatccagccatccaagctgccatcgacctcacggcaggggccgcagggggcacagcatgcgtcctgactgggcagcccttcgacaccatgaaggtgaagatgcagacatttccagacctctaccgcggcctcactgactgctgcctgaggacctactcccaggtgggcttcagaggcttctacaaggggaccagccccgcactgatcgccaatatcgcagagaactcggtgcttttcatgtgttacggcttctgccagcaggtggtccgcaaagtggttggattggaccggcaggcaaaactgagtgaccttcagaacgcagctgctggctcctttgcttctgcttttgccgctctggttctctgccctacagagcttgtgaagtgccggctacagaccatgtatgaaatggagacgtcgggaaagatagcggccagccagaatacagtttggtcagtcgtgaaggaaatcttcaggaaggatggccccctgggtttctaccatggcctctcaagcactttacttcgagaagtaccaggctatttcttcttctttggtggctatgaactgagcagatcatttttcgcatcagggagatccaaagatgaactgggtcctatcccgctcatgctaagtggtggatttggtgggatttgcctgtggcttgctgtgtatccggtggattgtatcaaatctagaattcaagttctttctatgaccggaaagcagacgggactcatcagaaccttcctgagtatcgtaaagaatgaaggaggatacagactttcagagtcacggctctatgacgtcagcttcgtgcagccaaagacctgtctttctggtgtccactatgtaggcatcttaaaactagggttacgggaaggaataacagccttgtattctggactgaaacccaccatgatccgcgctttccctgccaacggggcactgtttttggcctacgagtatagcaggaagttgatgatgagccaactggaagcatgctgaagtgtcctggtgtgcctggagtcaaggcaggcgtttagcgactggttaactcagggtttcacggagtacaagaacaatgtggaattatgtgattcattgggactttgtccttgtcttcccttcttctattcaaagtcttggattttgtggatggtcctctgttctacacagtgtaatttctgcctgttactgaaccaaaacagaaaagtcactgttctcgtccttggcctcatgcacaggggagctggtggcctcatgcactggctttatgtaccttgtgcaggccctgttcctctcaggataacttccgtggaagtcagctgtacacatgcaatttagatggtcctgtcgtgaggaaaacaaatttttgttctatgtttaactgcaaacggtgaccaatttttacgtaggtggttgtaaatgattgcctaacacatcctagctagagggccgctgctaaaagccgctgagcctgtgcactaagaggttagagcttttgactttttgtggtatattaaagctaaaatacccatctataaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]