ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-11-05 15:34:02, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001047880 1639 bp mRNA linear ROD 27-APR-2025
DEFINITION Rattus norvegicus solute carrier family 25 member 15 (Slc25a15),
mRNA; nuclear gene for mitochondrial product.
ACCESSION NM_001047880 XM_001064456 XM_001064514 XM_001064627 XM_001064682
XM_224969
VERSION NM_001047880.3
KEYWORDS RefSeq; RefSeq Select.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 1639)
AUTHORS Da Cruz,S., Xenarios,I., Langridge,J., Vilbois,F., Parone,P.A. and
Martinou,J.C.
TITLE Proteomic analysis of the mouse liver mitochondrial inner membrane
JOURNAL J Biol Chem 278 (42), 41566-41571 (2003)
PUBMED 12865426
REFERENCE 2 (bases 1 to 1639)
AUTHORS Fiermonte,G., Dolce,V., David,L., Santorelli,F.M., Dionisi-Vici,C.,
Palmieri,F. and Walker,J.E.
TITLE The mitochondrial ornithine transporter. Bacterial expression,
reconstitution, functional characterization, and tissue
distribution of two human isoforms
JOURNAL J Biol Chem 278 (35), 32778-32783 (2003)
PUBMED 12807890
REFERENCE 3 (bases 1 to 1639)
AUTHORS Camacho,J.A., Rioseco-Camacho,N., Andrade,D., Porter,J. and Kong,J.
TITLE Cloning and characterization of human ORNT2: a second mitochondrial
ornithine transporter that can rescue a defective ORNT1 in patients
with the hyperornithinemia-hyperammonemia-homocitrullinuria
syndrome, a urea cycle disorder
JOURNAL Mol Genet Metab 79 (4), 257-271 (2003)
PUBMED 12948741
REFERENCE 4 (bases 1 to 1639)
AUTHORS Morris,S.M. Jr. and Kepka-Lenhart,D.
TITLE Hormonal induction of hepatic mitochondrial ornithine/citrulline
transporter mRNA
JOURNAL Biochem Biophys Res Commun 294 (4), 749-752 (2002)
PUBMED 12061769
REMARK GeneRIF: Transcriptional Activation of ORNT1 mRNA by dexamethasone
in hepatocytes.
REFERENCE 5 (bases 1 to 1639)
AUTHORS Tsujino,S., Kanazawa,N., Ohashi,T., Eto,Y., Saito,T., Kira,J. and
Yamada,T.
TITLE Three novel mutations (G27E, insAAC, R179X) in the ORNT1 gene of
Japanese patients with hyperornithinemia, hyperammonemia, and
homocitrullinuria syndrome
JOURNAL Ann Neurol 47 (5), 625-631 (2000)
PUBMED 10805333
REFERENCE 6 (bases 1 to 1639)
AUTHORS Camacho,J.A., Obie,C., Biery,B., Goodman,B.K., Hu,C.A.,
Almashanu,S., Steel,G., Casey,R., Lambert,M., Mitchell,G.A. and
Valle,D.
TITLE Hyperornithinaemia-hyperammonaemia-homocitrullinuria syndrome is
caused by mutations in a gene encoding a mitochondrial ornithine
transporter
JOURNAL Nat Genet 22 (2), 151-158 (1999)
PUBMED 10369256
REFERENCE 7 (bases 1 to 1639)
AUTHORS Indiveri,C., Tonazzi,A., Stipani,I. and Palmieri,F.
TITLE The purified and reconstituted ornithine/citrulline carrier from
rat liver mitochondria: electrical nature and coupling of the
exchange reaction with H+ translocation
JOURNAL Biochem J 327 (Pt 2) (Pt 2), 349-355 (1997)
PUBMED 9359400
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
CA339807.1, AY325139.1 and DY310527.1.
On Jul 1, 2017 this sequence version replaced NM_001047880.2.
##Evidence-Data-START##
CDS exon combination :: AY325139.1 [ECO:0000331]
RNAseq introns :: partial sample support SAMD00132261,
SAMD00132262 [ECO:0000350]
##Evidence-Data-END##
##RefSeq-Attributes-START##
gene product(s) localized to mito. :: inferred from homology
RefSeq Select criteria :: based on conservation,
longest protein
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-60 CA339807.1 142-201
61-1078 AY325139.1 41-1058
1079-1639 DY310527.1 54-614
FEATURES Location/Qualifiers
source 1..1639
/organism="Rattus norvegicus"
/mol_type="mRNA"
/db_xref="taxon:10116"
/chromosome="16"
/map="16q12.5"
gene 1..1639
/gene="Slc25a15"
/gene_synonym="Ab1-114; Ornt1"
/note="solute carrier family 25 member 15"
/db_xref="GeneID:306574"
/db_xref="RGD:1311488"
exon 1..115
/gene="Slc25a15"
/gene_synonym="Ab1-114; Ornt1"
/inference="alignment:Splign:2.1.0"
CDS 61..1077
/gene="Slc25a15"
/gene_synonym="Ab1-114; Ornt1"
/note="ornithine transporter) member 15; solute carrier
family 25 (mitochondrial carrier; ornithine transporter)
member 15"
/codon_start=1
/product="mitochondrial ornithine transporter 1"
/protein_id="NP_001041345.1"
/db_xref="GeneID:306574"
/db_xref="RGD:1311488"
/translation="
MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLRTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVVGLDRQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAASQNTVWSVVKEIFRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPIPLMLSGGFGGICLWLAVYPVDCIKSRIQVLSMTGKQTGLIRTFLSIVKNEGGYRLSESRLYDVSFVQPKTCLSGVHYVGILKLGLREGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMSQLEAC"
misc_feature 85..342
/gene="Slc25a15"
/gene_synonym="Ab1-114; Ornt1"
/note="Mitochondrial carrier protein; Region: Mito_carr;
pfam00153"
/db_xref="CDD:395101"
misc_feature <424..654
/gene="Slc25a15"
/gene_synonym="Ab1-114; Ornt1"
/note="Mitochondrial carrier protein; Region: Mito_carr;
pfam00153"
/db_xref="CDD:395101"
misc_feature 673..1056
/gene="Slc25a15"
/gene_synonym="Ab1-114; Ornt1"
/note="Mitochondrial carrier protein; Region: Mito_carr;
pfam00153"
/db_xref="CDD:395101"
exon 116..374
/gene="Slc25a15"
/gene_synonym="Ab1-114; Ornt1"
/inference="alignment:Splign:2.1.0"
exon 375..512
/gene="Slc25a15"
/gene_synonym="Ab1-114; Ornt1"
/inference="alignment:Splign:2.1.0"
exon 513..682
/gene="Slc25a15"
/gene_synonym="Ab1-114; Ornt1"
/inference="alignment:Splign:2.1.0"
exon 683..841
/gene="Slc25a15"
/gene_synonym="Ab1-114; Ornt1"
/inference="alignment:Splign:2.1.0"
exon 842..952
/gene="Slc25a15"
/gene_synonym="Ab1-114; Ornt1"
/inference="alignment:Splign:2.1.0"
exon 953..1615
/gene="Slc25a15"
/gene_synonym="Ab1-114; Ornt1"
/inference="alignment:Splign:2.1.0"
ORIGIN
ggatatgtggttcacatccttccctccagagaattgccttcaacagaaaccagtaacgccatgaagtccaatccagccatccaagctgccatcgacctcacggcaggggccgcagggggcacagcatgcgtcctgactgggcagcccttcgacaccatgaaggtgaagatgcagacatttccagacctctaccgcggcctcactgactgctgcctgaggacctactcccaggtgggcttcagaggcttctacaaggggaccagccccgcactgatcgccaatatcgcagagaactcggtgcttttcatgtgttacggcttctgccagcaggtggtccgcaaagtggttggattggaccggcaggcaaaactgagtgaccttcagaacgcagctgctggctcctttgcttctgcttttgccgctctggttctctgccctacagagcttgtgaagtgccggctacagaccatgtatgaaatggagacgtcgggaaagatagcggccagccagaatacagtttggtcagtcgtgaaggaaatcttcaggaaggatggccccctgggtttctaccatggcctctcaagcactttacttcgagaagtaccaggctatttcttcttctttggtggctatgaactgagcagatcatttttcgcatcagggagatccaaagatgaactgggtcctatcccgctcatgctaagtggtggatttggtgggatttgcctgtggcttgctgtgtatccggtggattgtatcaaatctagaattcaagttctttctatgaccggaaagcagacgggactcatcagaaccttcctgagtatcgtaaagaatgaaggaggatacagactttcagagtcacggctctatgacgtcagcttcgtgcagccaaagacctgtctttctggtgtccactatgtaggcatcttaaaactagggttacgggaaggaataacagccttgtattctggactgaaacccaccatgatccgcgctttccctgccaacggggcactgtttttggcctacgagtatagcaggaagttgatgatgagccaactggaagcatgctgaagtgtcctggtgtgcctggagtcaaggcaggcgtttagcgactggttaactcagggtttcacggagtacaagaacaatgtggaattatgtgattcattgggactttgtccttgtcttcccttcttctattcaaagtcttggattttgtggatggtcctctgttctacacagtgtaatttctgcctgttactgaaccaaaacagaaaagtcactgttctcgtccttggcctcatgcacaggggagctggtggcctcatgcactggctttatgtaccttgtgcaggccctgttcctctcaggataacttccgtggaagtcagctgtacacatgcaatttagatggtcctgtcgtgaggaaaacaaatttttgttctatgtttaactgcaaacggtgaccaatttttacgtaggtggttgtaaatgattgcctaacacatcctagctagagggccgctgctaaaagccgctgagcctgtgcactaagaggttagagcttttgactttttgtggtatattaaagctaaaatacccatctataaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]