LOCUS       NM_001017480            1235 bp    mRNA    linear   ROD 06-OCT-2024
DEFINITION  Rattus norvegicus homeo box B7 (Hoxb7), mRNA.
ACCESSION   NM_001017480 XM_573181
VERSION     NM_001017480.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1235)
  AUTHORS   Li,H., Shen,L.Y., Yan,W.P., Dong,B., Kang,X.Z., Dai,L., Yang,Y.B.,
            Fu,H., Yang,H.L., Zhou,H.T., Huang,C., Liang,Z., Xiong,H.C. and
            Chen,K.N.
  TITLE     Deregulated HOXB7 Expression Predicts Poor Prognosis of Patients
            with Esophageal Squamous Cell Carcinoma and Regulates Cancer Cell
            Proliferation In Vitro and In Vivo
  JOURNAL   PLoS One 10 (6), e0130551 (2015)
   PUBMED   26076456
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1235)
  AUTHORS   Yuan,W., Zhang,X., Xu,Y., Li,S., Hu,Y. and Wu,S.
  TITLE     Role of HOXB7 in regulation of progression and metastasis of human
            lung adenocarcinoma
  JOURNAL   Mol Carcinog 53 (1), 49-57 (2014)
   PUBMED   22911672
REFERENCE   3  (bases 1 to 1235)
  AUTHORS   Murawski,I.J., Myburgh,D.B., Favor,J. and Gupta,I.R.
  TITLE     Vesico-ureteric reflux and urinary tract development in the Pax2
            1Neu+/- mouse
  JOURNAL   Am J Physiol Renal Physiol 293 (5), F1736-F1745 (2007)
   PUBMED   17881463
REFERENCE   4  (bases 1 to 1235)
  AUTHORS   Wu,X., Chen,H., Parker,B., Rubin,E., Zhu,T., Lee,J.S., Argani,P.
            and Sukumar,S.
  TITLE     HOXB7, a homeodomain protein, is overexpressed in breast cancer and
            confers epithelial-mesenchymal transition
  JOURNAL   Cancer Res 66 (19), 9527-9534 (2006)
   PUBMED   17018609
  REMARK    Erratum:[Cancer Res. 2015 Jun 1;75(11):2401. doi:
            10.1158/0008-5472.CAN-15-0936. PMID: 26032426]
REFERENCE   5  (bases 1 to 1235)
  AUTHORS   Medina-Martinez,O., Bradley,A. and Ramirez-Solis,R.
  TITLE     A large targeted deletion of Hoxb1-Hoxb9 produces a series of
            single-segment anterior homeotic transformations
  JOURNAL   Dev Biol 222 (1), 71-83 (2000)
   PUBMED   10885747
REFERENCE   6  (bases 1 to 1235)
  AUTHORS   Care,A., Silvani,A., Meccia,E., Mattia,G., Stoppacciaro,A.,
            Parmiani,G., Peschle,C. and Colombo,M.P.
  TITLE     HOXB7 constitutively activates basic fibroblast growth factor in
            melanomas
  JOURNAL   Mol Cell Biol 16 (9), 4842-4851 (1996)
   PUBMED   8756643
REFERENCE   7  (bases 1 to 1235)
  AUTHORS   Chung,S.Y., Dai,P.H., Lei,J., Riviere,M., Levan,G., Szpirer,J. and
            Szpirer,C.
  TITLE     Chromosomal assignment of seven rat homeobox genes to rat
            chromosomes 3, 4, 7, and 10
  JOURNAL   Mamm Genome 4 (9), 537-540 (1993)
   PUBMED   7906969
REFERENCE   8  (bases 1 to 1235)
  AUTHORS   de Jong,R., de Laaf,L., Vennema,H. and Meijlink,F.
  TITLE     DNA-binding activity of the murine homeodomain protein Hox-2.3
            produced by a hybrid phage T7/vaccinia virus system
  JOURNAL   Gene 116 (2), 195-203 (1992)
   PUBMED   1353046
REFERENCE   9  (bases 1 to 1235)
  AUTHORS   Wu,J., Zhu,J.Q., Zhu,D.X., Scharfman,A., Lamblin,G. and Han,K.K.
  TITLE     Selective inhibition of normal murine myelopoiesis 'in vitro' by a
            Hox 2.3 antisense oligodeoxynucleotide
  JOURNAL   Cell Mol Biol 38 (4), 367-376 (1992)
   PUBMED   1354076
REFERENCE   10 (bases 1 to 1235)
  AUTHORS   Falzon,M. and Chung,S.Y.
  TITLE     The expression of rat homeobox-containing genes is developmentally
            regulated and tissue specific
  JOURNAL   Development 103 (3), 601-610 (1988)
   PUBMED   2907739
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC079340.1.
            
            On Apr 29, 2005 this sequence version replaced XM_573181.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC079340.1, CK480314.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760384, SAMEA5760389
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1235
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="10"
                     /map="10q26"
     gene            1..1235
                     /gene="Hoxb7"
                     /gene_synonym="Hox2r1b; R1b"
                     /note="homeo box B7"
                     /db_xref="GeneID:497985"
                     /db_xref="RGD:1559918"
     exon            1..419
                     /gene="Hoxb7"
                     /gene_synonym="Hox2r1b; R1b"
                     /inference="alignment:Splign:2.1.0"
     CDS             20..679
                     /gene="Hoxb7"
                     /gene_synonym="Hox2r1b; R1b"
                     /note="homeobox gene B7; homeobox protein R1B"
                     /codon_start=1
                     /product="homeobox protein Hox-B7"
                     /protein_id="NP_001017480.1"
                     /db_xref="GeneID:497985"
                     /db_xref="RGD:1559918"
                     /translation="

MSSLYYANALFSKYPAASSVFAPGAFPEQTSCAFASNPQRPGYGAGPGAPFSASVQGLYSGGGGMAGQSAAGVYEAGYGLEPSSFNMHCAPFEQNLSGVCPGDPAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTERKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTSGPGTTGQDKAEADEEEEEEE"

     misc_feature    395..412
                     /gene="Hoxb7"
                     /gene_synonym="Hox2r1b; R1b"
                     /note="propagated from UniProtKB/Swiss-Prot (P18864.2);
                     Region: Antp-type hexapeptide"
     misc_feature    431..601
                     /gene="Hoxb7"
                     /gene_synonym="Hox2r1b; R1b"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    596..676
                     /gene="Hoxb7"
                     /gene_synonym="Hox2r1b; R1b"
                     /note="propagated from UniProtKB/Swiss-Prot (P18864.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            420..1213
                     /gene="Hoxb7"
                     /gene_synonym="Hox2r1b; R1b"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

caaatcatccggccaaattatgagttcattgtattatgcgaatgctttattttctaaatatccagccgcaagttcggttttcgctccaggagccttccccgaacaaacttcttgcgcctttgcctccaacccccagcgcccgggctatggagcaggtccgggcgcccccttctccgcctcggtgcagggtctgtactccggcggtgggggcatggcgggccagagcgcggccggcgtctatgaggccggctacgggctcgaaccgagttccttcaacatgcactgcgcgccctttgagcagaacctctccggggtgtgtccgggcgaccccgccaaggcggctggcgccaaggagcagagggactcggacttggcggccgagagtaacttccggatctacccctggatgcgaagctcagggactgaacgaaagcggggccgccagacctatacgcgctaccagaccctggagctggagaaagaatttcactacaatcgctacctgactcggcggcggcgcatcgagatcgcgcacgcgctctgcctcaccgaaagacagatcaagatctggtttcagaaccggcgcatgaagtggaaaaaggagaacaaaacttcaggcccaggaaccactggccaggacaaggcggaagcggacgaggaggaagaggaggaagagtgagagacagagaaagggaagagaggaggaaagagaagagagggagaacccaattgtgggaactgaagcacggaactcaaataagggggcaaactgtttaagtgaagaagtctgaaattttaaggaaagagatgggtgaaatttgggtttcttactactgtaaaaaaaaatactacctatgggaaagtgtgtggtctgtttttgtacagtctgggaaggacattatctacctgctctgtggctttttggaatgtgcctccccttttctatgttgcgagtaaggtctttgtaacatcttgctgttttgtaagccctctttgaagctgtctttgtgaattgtggttccagatgagccgattaacctgtggctcctcacctaccatatacttcccagtagtactaagagggtcttagggagccccgaggatccactagcttctgagcctggtgcatttggctgctgattctagctcctaaccatgagcctctttctgtatatctgaaggatggaaaaaataaaaaaggattaaataccaaaaaaaaaaaaaaaaaaaaaaaa

//