2024-04-27 04:54:04, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001011889 1432 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus claudin 9 (Cldn9), mRNA. ACCESSION NM_001011889 XM_220203 VERSION NM_001011889.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1432) AUTHORS Harris HJ, Davis C, Mullins JG, Hu K, Goodall M, Farquhar MJ, Mee CJ, McCaffrey K, Young S, Drummer H, Balfe P and McKeating JA. TITLE Claudin association with CD81 defines hepatitis C virus entry JOURNAL J Biol Chem 285 (27), 21092-21102 (2010) PUBMED 20375010 REFERENCE 2 (bases 1 to 1432) AUTHORS Krause G, Winkler L, Mueller SL, Haseloff RF, Piontek J and Blasig IE. TITLE Structure and function of claudins JOURNAL Biochim Biophys Acta 1778 (3), 631-645 (2008) PUBMED 18036336 REMARK Review article REFERENCE 3 (bases 1 to 1432) AUTHORS Nunes FD, Lopez LN, Lin HW, Davies C, Azevedo RB, Gow A and Kachar B. TITLE Distinct subdomain organization and molecular composition of a tight junction with adherens junction features JOURNAL J Cell Sci 119 (Pt 23), 4819-4827 (2006) PUBMED 17130295 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000219.1. On Mar 29, 2021 this sequence version replaced NM_001011889.1. ##Evidence-Data-START## Transcript is intronless :: BC087664.1 [ECO:0000345] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1432 JACYVU010000219.1 747451-748882 c FEATURES Location/Qualifiers source 1..1432 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="10" /map="10q12" gene 1..1432 /gene="Cldn9" /note="claudin 9" /db_xref="GeneID:287099" /db_xref="RGD:1308999" exon 1..1432 /gene="Cldn9" /inference="alignment:Splign:2.1.0" misc_feature 361..363 /gene="Cldn9" /note="upstream in-frame stop codon" CDS 364..1017 /gene="Cldn9" /codon_start=1 /product="claudin-9" /protein_id="NP_001011889.1" /db_xref="GeneID:287099" /db_xref="RGD:1308999" /translation="
MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVLLLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPSHFERPRGPRLGYSIPSRSGASGLDKRDYV"
misc_feature 373..852 /gene="Cldn9" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
tcacagttccctgttttgagacaagctgtataccggctgagagaagacttcaaccaagaaagaacgtgagcagccagcagagagggacgcggctgttcctagtccgtggcggatctggaggggctgtgatgggctgaaggcttccaagaagacacaagcaatacagctgagcgggacctaaggacttcttcgtattcagtgagtatcagatgtgtgagaggcccgcagatgtgaggtctggcctggcctgaaatcaacagcttcccctactgagcagtgagaaccacccgaactccaacacggtgctcccaaccctgttgagtgattcaggctgagagctgtgaagaccggaggagcagatagatggcttccactggccttgaactcctcggcatgaccctggctgtgctaggctggctaggaaccctggtgtcctgtgccctgccactgtggaaggtgaccgccttcattggcaacagcatcgttgtggcccaagtggtatgggaggggctgtggatgtcctgtgtggtccagagcactgggcagatgcagtgcaaggtgtacgactcgctgctggcgctgccccaggacctgcaggctgccagagccctctgtgtcgtggccctcctgctggctttgctgggcctgctggtggctatcacgggcgcccagtgcaccacatgtgtggaggacgaaggtgccaaggcacgtattgtgctcaccgcaggggtcctcctcctcctctcgggcatcctggtgctcatccccgtctgctggacagcccatgccatcatccaggacttttataacccactggttgctgaagctctcaagagagagctgggggcttccctctacctgggctgggccgccgctgcactgctcatgctcggaggagggctcctctgctgtacgtgtcccccgtcccacttcgagaggccccgcggccccaggctgggctactccatcccttcccgttcaggtgcttcgggacttgataagagggactatgtgtgagctgaggcttcttccagaagcttccaccttgcggccttatacctggcactgggctacatccttctatctcatcaaattcatgcgcctgggaagttcacttctttatttggccaggattcggctctagagggtgtcagctggtttggcttgagccaaccctctgcggtggcagcaaccttgagaaaactgcagatactgggtaccctgcccatcgccgtctcccaggatattgctgtgatttactttcctggactgatttactctggaacctgggcctcaggccccttgccttcaaaattagatgtggactgtgacctactagggtttcagctggtcaagtctagcccaagcagtccctgaattcaagttgctcagccccctgcccaacctgggaataaaagcacattgtaactga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]