2025-09-18 23:06:55, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_066308808 3109 bp mRNA linear PLN 10-JUL-2024 DEFINITION PREDICTED: Oryza sativa Japonica Group protein argonaute 11-like (LOC4333733), mRNA. ACCESSION XM_066308808 VERSION XM_066308808.1 DBLINK BioProject: PRJNA1123306 KEYWORDS RefSeq; corrected model. SOURCE Oryza sativa Japonica Group (Japanese rice) ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_089037) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_034140825.1-RS_2024_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/21/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 2 indels ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-542 CP132237.1 28050324-28050865 c 543-748 CP132237.1 28048407-28048612 c 749-901 CP132237.1 28048176-28048328 c 902-1016 CP132237.1 28047515-28047629 c 1017-1018 "NN" 1-2 1019-1032 CP132237.1 28047501-28047514 c 1033-1151 CP132237.1 28046088-28046206 c 1152-1252 CP132237.1 28045884-28045984 c 1253-1397 CP132237.1 28045664-28045808 c 1398-1514 CP132237.1 28045418-28045534 c 1515-1622 CP132237.1 28043939-28044046 c 1623-1694 CP132237.1 28043791-28043862 c 1695-1817 CP132237.1 28043180-28043302 c 1818-1995 CP132237.1 28042923-28043100 c 1996-2069 CP132237.1 28042736-28042809 c 2070-2117 CP132237.1 28042686-28042733 c 2118-2255 CP132237.1 28042434-28042571 c 2256-2398 CP132237.1 28040352-28040494 c 2399-2464 CP132237.1 28040192-28040257 c 2465-2528 CP132237.1 28040044-28040107 c 2529-2664 CP132237.1 28039801-28039936 c 2665-2738 CP132237.1 28039644-28039717 c 2739-2833 CP132237.1 28039048-28039142 c 2834-2865 CP132237.1 28038639-28038670 c 2866-3109 CP132237.1 28038206-28038449 c FEATURES Location/Qualifiers source 1..3109 /organism="Oryza sativa Japonica Group" /mol_type="mRNA" /db_xref="taxon:39947" /chromosome="3" gene 1..3109 /gene="LOC4333733" /note="protein argonaute 11-like; The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon; deleted 2 bases in 1 codon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 22 Proteins, and 31% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:4333733" CDS 66..3056 /gene="LOC4333733" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon; deleted 2 bases in 1 codon" /codon_start=1 /product="LOW QUALITY PROTEIN: protein argonaute 11-like" /protein_id="XP_066164905.1" /db_xref="GeneID:4333733" /translation="
MSSRGGGVGGRRGGPGGASSVRGGERGRKRGRGALDAVEPRVPLPRGTGSGPGAGRDGAAAPVPALQPAEADVLSGEVETEMAAGMEAREGASSSSSASAPAVGEVEPPSRAVGALPPTSSKAVVLQARPGFGTVGTSCRVRANHFVVQLADKEIYHYDVAIAPELRSRERNRNIINELLRSHKKYLDGRRSPAYDGRKGMFTAGALPFTDREFVVKIANDPERGNQGEKEFKVTIKCAGAANLYMHSLKQFLAGRQRELPQDTIQALDIALRECPSSRYISISRSFFSQAFGHKDIDCGVEWWRGYYQSLRPSQMGXSLNIDISATTFYKAQPVIDFALDYLNMNIRDAYSRCLRDQDRLKLKKALKGVRVETTHRRDVSIRYKITGLTSAPLKDCLYRFDQDGTRVSVVQYFNRQYSYSLKYINWPCLQAGSDSRPTYLPMEVCRIVKGQRYSRKLNECQVTRMLRLARETPEERENSILEIANENNYGNDYHAREFGIGVTNQLALVDARVLPAPMLKYHDSGQEKVCNPSIGQWNMNNKRMLNGGSINYWACLTFASCVRLAEVRTFCKELVRVCNSIGMQITGEPCVRIRQERQDHLDAAVRDIHRQSAEFLSQQGVIGQQLELLVIVLPDANATVFYGRIKRLCETELGVITQCCLARNVQNPPTQYLRNLALKINVKVGGRNTVLEDALHRRIPLLTDMPTMIFGADVTHPPAGEDSSPSIAAVVASMDWPEVSKYKCSVSSQSHREEIIADLFTEVKDSQNRLVYGGMIRELIESFRKANGSYKPGRIIFYRDGVSEGQFSQVLLSEMDAIRKACASIEEGYLPPVTFVVVQKRHHTRLFPEDHHARDQMDRSRNILPGTVVDTKICHPSEFDFYLCSHSGIQGTSHPTHYYVLFDENNFSADALQTLTYHLCYTYARCTRSVSIVPPVYYAHLAASRARHYLEEGSLPDHGSSSASAAGGSRRNDRGVPVKPLPEIKENVKQFMFYC"
misc_feature 651..881 /gene="LOC4333733" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 924..1058 /gene="LOC4333733" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1059..1412 /gene="LOC4333733" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1215..1217,1260..1262,1293..1295,1305..1307, 1359..1361,1380..1382,1386..1388) /gene="LOC4333733" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1548..2918 /gene="LOC4333733" /note="PIWI domain, Argonaute-like subfamily. Argonaute is the central component of the RNA-induced silencing complex (RISC) and related complexes. The PIWI domain is the C-terminal portion of Argonaute and consists of two subdomains, one of which provides the...; Region: Piwi_ago-like; cd04657" /db_xref="CDD:240015" misc_feature order(1992..1994,2004..2006,2040..2051,2058..2060, 2082..2084,2091..2093,2103..2105,2115..2117) /gene="LOC4333733" /note="5' RNA guide strand anchoring site [active]" /db_xref="CDD:240015" misc_feature order(2205..2207,2211..2213,2466..2468,2886..2888) /gene="LOC4333733" /note="active site" /db_xref="CDD:240015" ORIGIN
cagcttccattaatttccttccgtgggtttgcgtgcttctagctccgcttgcttgtctaccggccatgtcttcccgcggcggcggggtagggggccggcgcggtggccccggcggcgccagcagtgtccgtggcggcgagcgcggacgcaaacgcggtcgaggtgctttggacgccgtggagccccgcgtcccgcttccacggggcacgggatccggccctggggctggccgggacggagccgccgcgccggtgccggcgctgcaaccggcggaggcggatgtgctcagcggcgaggtggagacggagatggcggccgggatggaggcgcgcgagggggcgtcgtcgtcgtcgtctgcttcggcgccggcggtgggggaggtcgagccgccgtcgcgggcggtcggtgcgctgccgccgacgtcgagcaaggcggtggtgctccaggcgaggccggggttcgggacggtcgggacgagctgccgcgtccgcgccaaccatttcgtcgtgcagcttgccgacaaggagatctaccattacgatgttgccatcgcccctgaattgagatctcgagaaaggaacaggaatataatcaatgaacttttaagatcacacaaaaaatacttggatgggcggcgttcgcctgcttatgatggaagaaaaggcatgtttacggctggtgcattgccttttacagacagagagttcgttgtcaaaattgcaaacgaccctgagagaggaaaccagggggagaaagagttcaaagtgaccataaagtgtgctggtgctgcaaacttatatatgcacagccttaagcaattcttggctggtaggcagagagagctgccgcaagacactatccaggctcttgatatcgctcttagggaatgtcccagttcaaggtacatatccatctcaagatcgtttttctcacaagcatttggacataaggatattgattgtggcgttgaatggtggagagggtattaccagagtctacgcccctcgcagatgggannttctcttaatattgatatttctgcaacaacattttacaaggctcagccagtaattgactttgcattggactatctgaacatgaacattcgtgatgcttattcaaggtgtttacgtgatcaggaccgtctgaaactaaagaaagcccttaaaggagtccgggttgagaccacacatcgacgtgatgtgtccatacgttacaaaattactgggctaacttcagctcctttgaaggattgcttgtacaggtttgatcaagatgggacaagggtatcagttgtccagtacttcaatcgccaatacagttattctttgaaatatattaactggccgtgccttcaggctggcagcgacagcaggccaacatatttacctatggaggtttgccgcatagtaaaaggacaacgctattctagaaaattaaatgaatgtcaagtcacacgcatgttgaggttggcacgtgagacaccagaagaaagggagaatagtattttagagattgctaatgaaaacaactatggcaatgattatcatgccagagaatttggcatcggggtgacaaaccaacttgccttagtcgatgctcgtgtactccctgctccaatgcttaagtaccatgactctggacaagagaaagtatgtaatccttccattggtcagtggaacatgaataacaagaggatgctcaatggtggatccatcaattactgggcatgcttgacttttgcttcctgcgtacgtctggctgaagttaggacgttttgcaaggagttggttcgtgtgtgcaatagcattggcatgcaaattaccggggaaccatgtgtccgtattaggcaagaacgccaagatcacttagatgctgctgtcagagatatacatcgacaatctgcagaatttctttctcaacaaggtgtgatcgggcaacaacttgagttactggtaatagtactacctgatgcaaatgcaactgtcttttatggaaggataaagcggctttgtgaaactgaacttggtgtgataactcagtgctgtttagctaggaatgttcagaatccgccaacacaatatctccgaaacctggcacttaaaatcaatgttaaggttggtggacgaaatacagtactggaagatgctttgcataggagaattcctctgttaacagatatgcctacaatgatctttggagctgacgtgacccatccacctgccggggaggattcatctccatcaattgctgcggttgttgcatcgatggattggccagaagtgtcaaaatacaaatgctcggtttcttcgcaaagccatagggaagagatcatagctgatctcttcacagaggtgaaagattcacagaacagacttgtttatggtggaatgatcagagagttgatagagtctttccgtaaagcaaatggcagctacaaacctggaaggataatattttatcgagacggtgttagtgaaggccagtttagccaagttctgcttagtgaaatggatgcaattcggaaggcttgtgctagcatagaggagggctacctccctccagttacctttgttgtggtgcaaaagaggcatcacacccgtctttttcctgaagatcatcacgcgagggatcagatggatcgaagcagaaacatcttacctggaactgttgttgacactaagatatgccatcccagtgaatttgacttttacctttgtagccattctggcattcagggaacaagccaccccacgcattactatgttctattcgacgagaacaatttcagcgccgatgcattgcaaacattgacttaccatttgtgctacacatatgcacgctgcacgcgatcagtctccatagttcctccggtgtactatgcgcacctggcggcttccagagcgcggcactacctggaggagggatcactccccgaccacggatcgtcttctgcttctgcagccggcggttctcggcggaacgaccgtggtgtgccggtgaagccgctgccagagattaaggagaatgtgaagcagttcatgttttactgctgaagtaactagtccctccgtttcaggttataagactttctaccattgccgacatt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]