GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-07-07 10:01:07, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_066308808            3109 bp    mRNA    linear   PLN 10-JUL-2024
DEFINITION  PREDICTED: Oryza sativa Japonica Group protein argonaute 11-like
            (LOC4333733), mRNA.
ACCESSION   XM_066308808
VERSION     XM_066308808.1
DBLINK      BioProject: PRJNA1123306
KEYWORDS    RefSeq; corrected model.
SOURCE      Oryza sativa Japonica Group (Japanese rice)
  ORGANISM  Oryza sativa Japonica Group
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP
            clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_089037) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_034140825.1-RS_2024_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/21/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 2 indels
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-542               CP132237.1         28050324-28050865   c
            543-748             CP132237.1         28048407-28048612   c
            749-901             CP132237.1         28048176-28048328   c
            902-1016            CP132237.1         28047515-28047629   c
            1017-1018           "NN"               1-2
            1019-1032           CP132237.1         28047501-28047514   c
            1033-1151           CP132237.1         28046088-28046206   c
            1152-1252           CP132237.1         28045884-28045984   c
            1253-1397           CP132237.1         28045664-28045808   c
            1398-1514           CP132237.1         28045418-28045534   c
            1515-1622           CP132237.1         28043939-28044046   c
            1623-1694           CP132237.1         28043791-28043862   c
            1695-1817           CP132237.1         28043180-28043302   c
            1818-1995           CP132237.1         28042923-28043100   c
            1996-2069           CP132237.1         28042736-28042809   c
            2070-2117           CP132237.1         28042686-28042733   c
            2118-2255           CP132237.1         28042434-28042571   c
            2256-2398           CP132237.1         28040352-28040494   c
            2399-2464           CP132237.1         28040192-28040257   c
            2465-2528           CP132237.1         28040044-28040107   c
            2529-2664           CP132237.1         28039801-28039936   c
            2665-2738           CP132237.1         28039644-28039717   c
            2739-2833           CP132237.1         28039048-28039142   c
            2834-2865           CP132237.1         28038639-28038670   c
            2866-3109           CP132237.1         28038206-28038449   c
FEATURES             Location/Qualifiers
     source          1..3109
                     /organism="Oryza sativa Japonica Group"
                     /mol_type="mRNA"
                     /db_xref="taxon:39947"
                     /chromosome="3"
     gene            1..3109
                     /gene="LOC4333733"
                     /note="protein argonaute 11-like; The sequence of the
                     model RefSeq transcript was modified relative to its
                     source genomic sequence to represent the inferred CDS:
                     inserted 2 bases in 1 codon; deleted 2 bases in 1 codon;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 22 Proteins, and 31% coverage of the
                     annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:4333733"
     CDS             66..3056
                     /gene="LOC4333733"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: inserted 2 bases in 1 codon;
                     deleted 2 bases in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: protein argonaute 11-like"
                     /protein_id="XP_066164905.1"
                     /db_xref="GeneID:4333733"
                     /translation="
MSSRGGGVGGRRGGPGGASSVRGGERGRKRGRGALDAVEPRVPLPRGTGSGPGAGRDGAAAPVPALQPAEADVLSGEVETEMAAGMEAREGASSSSSASAPAVGEVEPPSRAVGALPPTSSKAVVLQARPGFGTVGTSCRVRANHFVVQLADKEIYHYDVAIAPELRSRERNRNIINELLRSHKKYLDGRRSPAYDGRKGMFTAGALPFTDREFVVKIANDPERGNQGEKEFKVTIKCAGAANLYMHSLKQFLAGRQRELPQDTIQALDIALRECPSSRYISISRSFFSQAFGHKDIDCGVEWWRGYYQSLRPSQMGXSLNIDISATTFYKAQPVIDFALDYLNMNIRDAYSRCLRDQDRLKLKKALKGVRVETTHRRDVSIRYKITGLTSAPLKDCLYRFDQDGTRVSVVQYFNRQYSYSLKYINWPCLQAGSDSRPTYLPMEVCRIVKGQRYSRKLNECQVTRMLRLARETPEERENSILEIANENNYGNDYHAREFGIGVTNQLALVDARVLPAPMLKYHDSGQEKVCNPSIGQWNMNNKRMLNGGSINYWACLTFASCVRLAEVRTFCKELVRVCNSIGMQITGEPCVRIRQERQDHLDAAVRDIHRQSAEFLSQQGVIGQQLELLVIVLPDANATVFYGRIKRLCETELGVITQCCLARNVQNPPTQYLRNLALKINVKVGGRNTVLEDALHRRIPLLTDMPTMIFGADVTHPPAGEDSSPSIAAVVASMDWPEVSKYKCSVSSQSHREEIIADLFTEVKDSQNRLVYGGMIRELIESFRKANGSYKPGRIIFYRDGVSEGQFSQVLLSEMDAIRKACASIEEGYLPPVTFVVVQKRHHTRLFPEDHHARDQMDRSRNILPGTVVDTKICHPSEFDFYLCSHSGIQGTSHPTHYYVLFDENNFSADALQTLTYHLCYTYARCTRSVSIVPPVYYAHLAASRARHYLEEGSLPDHGSSSASAAGGSRRNDRGVPVKPLPEIKENVKQFMFYC"
     misc_feature    651..881
                     /gene="LOC4333733"
                     /note="N-terminal domain of argonaute; Region: ArgoN;
                     pfam16486"
                     /db_xref="CDD:465134"
     misc_feature    924..1058
                     /gene="LOC4333733"
                     /note="Argonaute linker 1 domain; Region: ArgoL1;
                     pfam08699"
                     /db_xref="CDD:462567"
     misc_feature    1059..1412
                     /gene="LOC4333733"
                     /note="PAZ domain, argonaute_like subfamily. Argonaute is
                     part of the RNA-induced silencing complex (RISC), and is
                     an endonuclease that plays a key role in the RNA
                     interference pathway. The PAZ domain has been named after
                     the proteins Piwi,Argonaut, and Zwille; Region:
                     PAZ_argonaute_like; cd02846"
                     /db_xref="CDD:239212"
     misc_feature    order(1215..1217,1260..1262,1293..1295,1305..1307,
                     1359..1361,1380..1382,1386..1388)
                     /gene="LOC4333733"
                     /note="nucleic acid-binding interface [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239212"
     misc_feature    1548..2918
                     /gene="LOC4333733"
                     /note="PIWI domain, Argonaute-like subfamily. Argonaute is
                     the central component of the RNA-induced silencing complex
                     (RISC) and related complexes. The PIWI domain is the
                     C-terminal portion of Argonaute and consists of two
                     subdomains, one of which provides the...; Region:
                     Piwi_ago-like; cd04657"
                     /db_xref="CDD:240015"
     misc_feature    order(1992..1994,2004..2006,2040..2051,2058..2060,
                     2082..2084,2091..2093,2103..2105,2115..2117)
                     /gene="LOC4333733"
                     /note="5' RNA guide strand anchoring site [active]"
                     /db_xref="CDD:240015"
     misc_feature    order(2205..2207,2211..2213,2466..2468,2886..2888)
                     /gene="LOC4333733"
                     /note="active site"
                     /db_xref="CDD:240015"
ORIGIN      
cagcttccattaatttccttccgtgggtttgcgtgcttctagctccgcttgcttgtctaccggccatgtcttcccgcggcggcggggtagggggccggcgcggtggccccggcggcgccagcagtgtccgtggcggcgagcgcggacgcaaacgcggtcgaggtgctttggacgccgtggagccccgcgtcccgcttccacggggcacgggatccggccctggggctggccgggacggagccgccgcgccggtgccggcgctgcaaccggcggaggcggatgtgctcagcggcgaggtggagacggagatggcggccgggatggaggcgcgcgagggggcgtcgtcgtcgtcgtctgcttcggcgccggcggtgggggaggtcgagccgccgtcgcgggcggtcggtgcgctgccgccgacgtcgagcaaggcggtggtgctccaggcgaggccggggttcgggacggtcgggacgagctgccgcgtccgcgccaaccatttcgtcgtgcagcttgccgacaaggagatctaccattacgatgttgccatcgcccctgaattgagatctcgagaaaggaacaggaatataatcaatgaacttttaagatcacacaaaaaatacttggatgggcggcgttcgcctgcttatgatggaagaaaaggcatgtttacggctggtgcattgccttttacagacagagagttcgttgtcaaaattgcaaacgaccctgagagaggaaaccagggggagaaagagttcaaagtgaccataaagtgtgctggtgctgcaaacttatatatgcacagccttaagcaattcttggctggtaggcagagagagctgccgcaagacactatccaggctcttgatatcgctcttagggaatgtcccagttcaaggtacatatccatctcaagatcgtttttctcacaagcatttggacataaggatattgattgtggcgttgaatggtggagagggtattaccagagtctacgcccctcgcagatgggannttctcttaatattgatatttctgcaacaacattttacaaggctcagccagtaattgactttgcattggactatctgaacatgaacattcgtgatgcttattcaaggtgtttacgtgatcaggaccgtctgaaactaaagaaagcccttaaaggagtccgggttgagaccacacatcgacgtgatgtgtccatacgttacaaaattactgggctaacttcagctcctttgaaggattgcttgtacaggtttgatcaagatgggacaagggtatcagttgtccagtacttcaatcgccaatacagttattctttgaaatatattaactggccgtgccttcaggctggcagcgacagcaggccaacatatttacctatggaggtttgccgcatagtaaaaggacaacgctattctagaaaattaaatgaatgtcaagtcacacgcatgttgaggttggcacgtgagacaccagaagaaagggagaatagtattttagagattgctaatgaaaacaactatggcaatgattatcatgccagagaatttggcatcggggtgacaaaccaacttgccttagtcgatgctcgtgtactccctgctccaatgcttaagtaccatgactctggacaagagaaagtatgtaatccttccattggtcagtggaacatgaataacaagaggatgctcaatggtggatccatcaattactgggcatgcttgacttttgcttcctgcgtacgtctggctgaagttaggacgttttgcaaggagttggttcgtgtgtgcaatagcattggcatgcaaattaccggggaaccatgtgtccgtattaggcaagaacgccaagatcacttagatgctgctgtcagagatatacatcgacaatctgcagaatttctttctcaacaaggtgtgatcgggcaacaacttgagttactggtaatagtactacctgatgcaaatgcaactgtcttttatggaaggataaagcggctttgtgaaactgaacttggtgtgataactcagtgctgtttagctaggaatgttcagaatccgccaacacaatatctccgaaacctggcacttaaaatcaatgttaaggttggtggacgaaatacagtactggaagatgctttgcataggagaattcctctgttaacagatatgcctacaatgatctttggagctgacgtgacccatccacctgccggggaggattcatctccatcaattgctgcggttgttgcatcgatggattggccagaagtgtcaaaatacaaatgctcggtttcttcgcaaagccatagggaagagatcatagctgatctcttcacagaggtgaaagattcacagaacagacttgtttatggtggaatgatcagagagttgatagagtctttccgtaaagcaaatggcagctacaaacctggaaggataatattttatcgagacggtgttagtgaaggccagtttagccaagttctgcttagtgaaatggatgcaattcggaaggcttgtgctagcatagaggagggctacctccctccagttacctttgttgtggtgcaaaagaggcatcacacccgtctttttcctgaagatcatcacgcgagggatcagatggatcgaagcagaaacatcttacctggaactgttgttgacactaagatatgccatcccagtgaatttgacttttacctttgtagccattctggcattcagggaacaagccaccccacgcattactatgttctattcgacgagaacaatttcagcgccgatgcattgcaaacattgacttaccatttgtgctacacatatgcacgctgcacgcgatcagtctccatagttcctccggtgtactatgcgcacctggcggcttccagagcgcggcactacctggaggagggatcactccccgaccacggatcgtcttctgcttctgcagccggcggttctcggcggaacgaccgtggtgtgccggtgaagccgctgccagagattaaggagaatgtgaagcagttcatgttttactgctgaagtaactagtccctccgtttcaggttataagactttctaccattgccgacatt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]