LOCUS       XM_026022702            2714 bp    mRNA    linear   PLN 07-AUG-2018
DEFINITION  PREDICTED: Oryza sativa Japonica Group protein argonaute MEL1-like
            (LOC9269807), mRNA.
ACCESSION   XM_026022702
VERSION     XM_026022702.1
DBLINK      BioProject: PRJNA122
KEYWORDS    RefSeq; corrected model.
SOURCE      Oryza sativa Japonica Group (Japanese rice)
  ORGANISM  Oryza sativa Japonica Group
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP
            clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_029257.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Oryza sativa Japonica Group
                                           Annotation Release 102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 2 indels
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-169               AP014958.1         24407388-24407556   c
            170-369             AP014958.1         24406848-24407047   c
            370-510             AP014958.1         24406612-24406752   c
            511-644             AP014958.1         24406356-24406489   c
            645-754             AP014958.1         24404659-24404768   c
            755-861             AP014958.1         24404464-24404570   c
            862-1000            AP014958.1         24404233-24404371   c
            1001-1117           AP014958.1         24404050-24404166   c
            1118-1219           AP014958.1         24403830-24403931   c
            1220-1291           AP014958.1         24403670-24403741   c
            1292-1378           AP014958.1         24396414-24396500   c
            1379-1379           "N"                1-1
            1380-1411           AP014958.1         24396382-24396413   c
            1412-1553           AP014958.1         24396152-24396293   c
            1554-1678           AP014958.1         24395953-24396077   c
            1679-1816           AP014958.1         24395737-24395874   c
            1817-1858           AP014958.1         24395490-24395531   c
            1859-1860           "NN"               1-2
            1861-1959           AP014958.1         24395391-24395489   c
            1960-2022           AP014958.1         24395235-24395297   c
            2023-2086           AP014958.1         24395095-24395158   c
            2087-2219           AP014958.1         24394885-24395017   c
            2220-2290           AP014958.1         24394243-24394313   c
            2291-2385           AP014958.1         24391324-24391418   c
            2386-2417           AP014958.1         24391199-24391230   c
            2418-2714           AP014958.1         24390601-24390897   c
FEATURES             Location/Qualifiers
     source          1..2714
                     /organism="Oryza sativa Japonica Group"
                     /mol_type="mRNA"
                     /cultivar="Nipponbare"
                     /db_xref="taxon:39947"
                     /chromosome="2"
     gene            1..2714
                     /gene="LOC9269807"
                     /note="The sequence of the model RefSeq transcript was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: inserted 3 bases in 2 codons;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 3 ESTs, 15 Proteins, and 96% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 1 sample with support for all annotated introns"
                     /db_xref="GeneID:9269807"
     CDS             23..2584
                     /gene="LOC9269807"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: inserted 3 bases in 2 codons"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: protein argonaute
                     MEL1-like"
                     /protein_id="XP_025878487.1"
                     /db_xref="GeneID:9269807"
                     /translation="

MVCGEVPAYKERVDSLAARPGYGSAGKKLSIFTNYFGVSVNCPAIYLYKVSIHPEPKLGVTKKAVLSEIVKLHGERVFRNKIPVFDTRKSLYTAHALPIVSETFVIKLDDDEDKTRTKGVHEVTIQFYKRIDLQDLQSYHTRRNASQGAIQAIDAVVRVLLSSCLSAPGTIFSTKFGPIIDTQEGLEFWRGCYKGVRLSQFGPGLNIDIPAAPFYKPLPVVEFVAELLNRTDVNQLFSTEEYDKVEKALQGVFVETTHRTDKTIRYKIKGLSVVPLEDLMFAEGAKENFTTTVVDYFQKRYKYKLKYIYWPCLQCGSSRDIFLPMEVCKILPGQRYCRKLTTRQAAKLLKATCERPHIRKIAIMKVRNNCNVERCVEEFGIRVNGLPAIVCGRILPTPELKYHVSGNEKTCVPTGGRWNMINKKLVNGGKVERWACLNFSKVPASTVKIFCGXMIKTCNFLGMDFKEWPLVPLWSINDLNIAAALKSIHSTAKEQLQLLIVILPEERGNYGKIKRVCETKLGLVSQCCLPKNVKTDTNIKYLENIALKINVKVGGQNTVLQQAFVHNGIPFVSDIPTIIFGADVSHPPPGMYSSSIAGVVGSIDWPEVTTYRXLISAQLERQEIIGGLFHSTRDPKGCLKPDGMIRELMMNFYQRNRRKPERIIFYRDGISESQFSQVIIHEVDAIRKACLSLQEDYLPPITLVIVQKRHHTRIFPHTLCSNYTEQVAQIPSGTVIDQDICHPSGFDFYLCSHTSQGNSRPTHYTVIFDENHFTADGLQLLTHNLCYMYARCTRAVSIVPPLYYAHLAAARGRSYLGKFGDGSSIRNEVSSELPEFLKVPKIADRVLGVMFYC"

     misc_feature    269..493
                     /gene="LOC9269807"
                     /note="N-terminal domain of argonaute; Region: ArgoN;
                     pfam16486"
                     /db_xref="CDD:435368"
     misc_feature    536..670
                     /gene="LOC9269807"
                     /note="Argonaute linker 1 domain; Region: ArgoL1;
                     pfam08699"
                     /db_xref="CDD:430160"
     misc_feature    671..1015
                     /gene="LOC9269807"
                     /note="PAZ domain, argonaute_like subfamily. Argonaute is
                     part of the RNA-induced silencing complex (RISC), and is
                     an endonuclease that plays a key role in the RNA
                     interference pathway. The PAZ domain has been named after
                     the proteins Piwi,Argonaut, and Zwille; Region:
                     PAZ_argonaute_like; cd02846"
                     /db_xref="CDD:239212"
     misc_feature    order(818..820,863..865,899..901,911..913,965..967,
                     983..985,989..991)
                     /gene="LOC9269807"
                     /note="nucleic acid-binding interface [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239212"
     misc_feature    1145..2470
                     /gene="LOC9269807"
                     /note="PIWI domain, Argonaute-like subfamily. Argonaute is
                     the central component of the RNA-induced silencing complex
                     (RISC) and related complexes. The PIWI domain is the
                     C-terminal portion of Argonaute and consists of two
                     subdomains, one of which provides the...; Region:
                     Piwi_ago-like; cd04657"
                     /db_xref="CDD:240015"
     misc_feature    order(1550..1552,1562..1564,1598..1609,1616..1618,
                     1643..1645,1652..1654,1664..1666,1676..1678)
                     /gene="LOC9269807"
                     /note="5' RNA guide strand anchoring site [active]"
                     /db_xref="CDD:240015"
     misc_feature    order(1769..1771,1775..1777,2024..2026,2438..2440)
                     /gene="LOC9269807"
                     /note="active site"
                     /db_xref="CDD:240015"
ORIGIN      

tgttgcagtagatgatgatgagatggtatgtggggaggtccctgcgtacaaagagagggtggattcccttgcagcgcgcccagggtatggatcagccggaaaaaagttgtccatctttacaaactatttcggggtatctgtgaattgccctgcaatctatctgtacaaagtttccatccaccctgagccaaaattaggagttactaaaaaagctgtgctttcagagattgttaaattgcatggagaaagagttttcagaaacaagatacctgtttttgatactagaaaaagcttgtatactgcacatgcactccctattgtgtcagaaacatttgtgatcaaacttgatgatgatgaagacaaaacaaggacaaaaggagttcatgaggtcacaattcagttttataaaaggatagacttacaagatctacaaagctaccatactagaaggaatgcctcccaaggtgctatacaggcgattgacgctgttgttagagtgctgctttctagttgtctcagtgctcctgggacgatcttttcgactaagtttggtcccataatagacacccaggagggattggagttttggagagggtgctacaagggtgtgcgcttgtcacagtttggtcctggtctaaatatagatataccagcagcaccattttataaacctcttccagtggtggaatttgtggctgagcttttgaatagaactgatgtcaaccaactattttctacagaggaatatgacaaggtagagaaagcactgcagggtgtttttgttgaaaccacccatcgaacagacaaaaccataagatacaagattaaagggctttctgtcgttcccttggaagacctcatgtttgctgagggcgctaaagaaaattttactacaactgtggttgattattttcagaagcgttacaaatacaaattgaagtacatttattggccatgtttgcagtgtggaagctctcgtgatattttcttacccatggaggtttgcaagattttaccagggcaaaggtactgtcggaagcttactacgagacaggcagctaagctattgaaggcaacttgtgaacggccccatattaggaagatcgcaattatgaaggttcgcaacaactgtaacgttgagaggtgtgtggaggagtttggaattagagttaatggtcttcctgccattgtgtgtggccgcatcttgcctacacctgagctgaagtaccatgtctccgggaatgagaaaacgtgtgtgcctactggcggacgatggaacatgatcaataagaaattggtaaatggaggaaaagtcgagagatgggcttgtttaaatttttcaaaagtacctgcttcaacagttaagatattctgtggtnaaatgatcaagacgtgcaacttccttggaatggatttcaaagagtggccattggtaccattatggtctattaatgatctgaacatagctgctgcattgaagtctattcacagcactgcaaaagaacaactccagctattaattgtcattcttccggaagaaagaggcaactatggaaaaattaagcgtgtatgtgagaccaagcttggactggtttctcagtgctgcttaccaaagaatgttaaaacagatacaaatataaaatacctcgagaatattgcccttaagataaatgtcaaggttggagggcagaatacagttcttcagcaagcgtttgttcataatggaataccgttcgtgtcagacataccgacaatcatttttggtgctgatgttagccatcccccaccagggatgtactcgtcatctattgcaggagtggttggatcaatcgactggccagaagtcaccacatataganngctaatctctgcccaacttgaaaggcaggagattataggaggtctatttcattctactcgagatccaaaagggtgccttaaacctgatggcatgatcagggaactgatgatgaacttctaccagaggaataggcgtaagcctgaaaggataatcttttacagagatggaataagcgaaagtcaattcagccaggttatcattcatgaagtagatgccatcaggaaggcatgcctctctctacaagaggattatctgccaccaatcacattagtgattgtccagaaaaggcatcacaccaggattttccctcacacactttgcagtaattatactgaacaagttgcacagattccctctggaactgtgattgaccaagacatatgccatccttcgggttttgatttttatttgtgtagccatacttctcagggaaacagtagacctacgcattatacagttatcttcgatgaaaatcatttcactgctgacgggcttcagttgcttacacacaacctatgttacatgtatgcacgatgcacccgtgctgtttctatagttcccccactatactatgctcatcttgctgcagcccgaggacgaagctatctcgggaagtttggcgatggatcaagcatcaggaatgaagtgtcttctgagttgcctgagtttctgaaggttccaaagattgctgatcgtgtcctaggcgtgatgttctactgttaaatgcttgtggactgtggtgacctgtctcctagggttgtactctctcctttccatactattagacgttttgacctcaacatctcttgcttagatttactaatattcattcatatgaattttgactcatata

//