2024-04-24 23:25:04, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_026022702 2714 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group protein argonaute MEL1-like (LOC9269807), mRNA. ACCESSION XM_026022702 VERSION XM_026022702.1 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq; corrected model. SOURCE Oryza sativa Japonica Group (Japanese rice) ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_029257.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Oryza sativa Japonica Group Annotation Release 102 Annotation Version :: 102 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 2 indels ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-169 AP014958.1 24407388-24407556 c 170-369 AP014958.1 24406848-24407047 c 370-510 AP014958.1 24406612-24406752 c 511-644 AP014958.1 24406356-24406489 c 645-754 AP014958.1 24404659-24404768 c 755-861 AP014958.1 24404464-24404570 c 862-1000 AP014958.1 24404233-24404371 c 1001-1117 AP014958.1 24404050-24404166 c 1118-1219 AP014958.1 24403830-24403931 c 1220-1291 AP014958.1 24403670-24403741 c 1292-1378 AP014958.1 24396414-24396500 c 1379-1379 "N" 1-1 1380-1411 AP014958.1 24396382-24396413 c 1412-1553 AP014958.1 24396152-24396293 c 1554-1678 AP014958.1 24395953-24396077 c 1679-1816 AP014958.1 24395737-24395874 c 1817-1858 AP014958.1 24395490-24395531 c 1859-1860 "NN" 1-2 1861-1959 AP014958.1 24395391-24395489 c 1960-2022 AP014958.1 24395235-24395297 c 2023-2086 AP014958.1 24395095-24395158 c 2087-2219 AP014958.1 24394885-24395017 c 2220-2290 AP014958.1 24394243-24394313 c 2291-2385 AP014958.1 24391324-24391418 c 2386-2417 AP014958.1 24391199-24391230 c 2418-2714 AP014958.1 24390601-24390897 c FEATURES Location/Qualifiers source 1..2714 /organism="Oryza sativa Japonica Group" /mol_type="mRNA" /cultivar="Nipponbare" /db_xref="taxon:39947" /chromosome="2" gene 1..2714 /gene="LOC9269807" /note="The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: inserted 3 bases in 2 codons; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 ESTs, 15 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:9269807" CDS 23..2584 /gene="LOC9269807" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 3 bases in 2 codons" /codon_start=1 /product="LOW QUALITY PROTEIN: protein argonaute MEL1-like" /protein_id="XP_025878487.1" /db_xref="GeneID:9269807" /translation="
MVCGEVPAYKERVDSLAARPGYGSAGKKLSIFTNYFGVSVNCPAIYLYKVSIHPEPKLGVTKKAVLSEIVKLHGERVFRNKIPVFDTRKSLYTAHALPIVSETFVIKLDDDEDKTRTKGVHEVTIQFYKRIDLQDLQSYHTRRNASQGAIQAIDAVVRVLLSSCLSAPGTIFSTKFGPIIDTQEGLEFWRGCYKGVRLSQFGPGLNIDIPAAPFYKPLPVVEFVAELLNRTDVNQLFSTEEYDKVEKALQGVFVETTHRTDKTIRYKIKGLSVVPLEDLMFAEGAKENFTTTVVDYFQKRYKYKLKYIYWPCLQCGSSRDIFLPMEVCKILPGQRYCRKLTTRQAAKLLKATCERPHIRKIAIMKVRNNCNVERCVEEFGIRVNGLPAIVCGRILPTPELKYHVSGNEKTCVPTGGRWNMINKKLVNGGKVERWACLNFSKVPASTVKIFCGXMIKTCNFLGMDFKEWPLVPLWSINDLNIAAALKSIHSTAKEQLQLLIVILPEERGNYGKIKRVCETKLGLVSQCCLPKNVKTDTNIKYLENIALKINVKVGGQNTVLQQAFVHNGIPFVSDIPTIIFGADVSHPPPGMYSSSIAGVVGSIDWPEVTTYRXLISAQLERQEIIGGLFHSTRDPKGCLKPDGMIRELMMNFYQRNRRKPERIIFYRDGISESQFSQVIIHEVDAIRKACLSLQEDYLPPITLVIVQKRHHTRIFPHTLCSNYTEQVAQIPSGTVIDQDICHPSGFDFYLCSHTSQGNSRPTHYTVIFDENHFTADGLQLLTHNLCYMYARCTRAVSIVPPLYYAHLAAARGRSYLGKFGDGSSIRNEVSSELPEFLKVPKIADRVLGVMFYC"
misc_feature 269..493 /gene="LOC9269807" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:435368" misc_feature 536..670 /gene="LOC9269807" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:430160" misc_feature 671..1015 /gene="LOC9269807" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(818..820,863..865,899..901,911..913,965..967, 983..985,989..991) /gene="LOC9269807" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1145..2470 /gene="LOC9269807" /note="PIWI domain, Argonaute-like subfamily. Argonaute is the central component of the RNA-induced silencing complex (RISC) and related complexes. The PIWI domain is the C-terminal portion of Argonaute and consists of two subdomains, one of which provides the...; Region: Piwi_ago-like; cd04657" /db_xref="CDD:240015" misc_feature order(1550..1552,1562..1564,1598..1609,1616..1618, 1643..1645,1652..1654,1664..1666,1676..1678) /gene="LOC9269807" /note="5' RNA guide strand anchoring site [active]" /db_xref="CDD:240015" misc_feature order(1769..1771,1775..1777,2024..2026,2438..2440) /gene="LOC9269807" /note="active site" /db_xref="CDD:240015" ORIGIN
tgttgcagtagatgatgatgagatggtatgtggggaggtccctgcgtacaaagagagggtggattcccttgcagcgcgcccagggtatggatcagccggaaaaaagttgtccatctttacaaactatttcggggtatctgtgaattgccctgcaatctatctgtacaaagtttccatccaccctgagccaaaattaggagttactaaaaaagctgtgctttcagagattgttaaattgcatggagaaagagttttcagaaacaagatacctgtttttgatactagaaaaagcttgtatactgcacatgcactccctattgtgtcagaaacatttgtgatcaaacttgatgatgatgaagacaaaacaaggacaaaaggagttcatgaggtcacaattcagttttataaaaggatagacttacaagatctacaaagctaccatactagaaggaatgcctcccaaggtgctatacaggcgattgacgctgttgttagagtgctgctttctagttgtctcagtgctcctgggacgatcttttcgactaagtttggtcccataatagacacccaggagggattggagttttggagagggtgctacaagggtgtgcgcttgtcacagtttggtcctggtctaaatatagatataccagcagcaccattttataaacctcttccagtggtggaatttgtggctgagcttttgaatagaactgatgtcaaccaactattttctacagaggaatatgacaaggtagagaaagcactgcagggtgtttttgttgaaaccacccatcgaacagacaaaaccataagatacaagattaaagggctttctgtcgttcccttggaagacctcatgtttgctgagggcgctaaagaaaattttactacaactgtggttgattattttcagaagcgttacaaatacaaattgaagtacatttattggccatgtttgcagtgtggaagctctcgtgatattttcttacccatggaggtttgcaagattttaccagggcaaaggtactgtcggaagcttactacgagacaggcagctaagctattgaaggcaacttgtgaacggccccatattaggaagatcgcaattatgaaggttcgcaacaactgtaacgttgagaggtgtgtggaggagtttggaattagagttaatggtcttcctgccattgtgtgtggccgcatcttgcctacacctgagctgaagtaccatgtctccgggaatgagaaaacgtgtgtgcctactggcggacgatggaacatgatcaataagaaattggtaaatggaggaaaagtcgagagatgggcttgtttaaatttttcaaaagtacctgcttcaacagttaagatattctgtggtnaaatgatcaagacgtgcaacttccttggaatggatttcaaagagtggccattggtaccattatggtctattaatgatctgaacatagctgctgcattgaagtctattcacagcactgcaaaagaacaactccagctattaattgtcattcttccggaagaaagaggcaactatggaaaaattaagcgtgtatgtgagaccaagcttggactggtttctcagtgctgcttaccaaagaatgttaaaacagatacaaatataaaatacctcgagaatattgcccttaagataaatgtcaaggttggagggcagaatacagttcttcagcaagcgtttgttcataatggaataccgttcgtgtcagacataccgacaatcatttttggtgctgatgttagccatcccccaccagggatgtactcgtcatctattgcaggagtggttggatcaatcgactggccagaagtcaccacatataganngctaatctctgcccaacttgaaaggcaggagattataggaggtctatttcattctactcgagatccaaaagggtgccttaaacctgatggcatgatcagggaactgatgatgaacttctaccagaggaataggcgtaagcctgaaaggataatcttttacagagatggaataagcgaaagtcaattcagccaggttatcattcatgaagtagatgccatcaggaaggcatgcctctctctacaagaggattatctgccaccaatcacattagtgattgtccagaaaaggcatcacaccaggattttccctcacacactttgcagtaattatactgaacaagttgcacagattccctctggaactgtgattgaccaagacatatgccatccttcgggttttgatttttatttgtgtagccatacttctcagggaaacagtagacctacgcattatacagttatcttcgatgaaaatcatttcactgctgacgggcttcagttgcttacacacaacctatgttacatgtatgcacgatgcacccgtgctgtttctatagttcccccactatactatgctcatcttgctgcagcccgaggacgaagctatctcgggaagtttggcgatggatcaagcatcaggaatgaagtgtcttctgagttgcctgagtttctgaaggttccaaagattgctgatcgtgtcctaggcgtgatgttctactgttaaatgcttgtggactgtggtgacctgtctcctagggttgtactctctcctttccatactattagacgttttgacctcaacatctcttgcttagatttactaatattcattcatatgaattttgactcatata
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]