GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-01-31 03:28:08, GGRNA.v2 : RefSeq release 227 (Nov, 2024)

LOCUS       XM_015788421            1111 bp    mRNA    linear   PLN 10-JUL-2024
DEFINITION  PREDICTED: Oryza sativa Japonica Group putative disease resistance
            RPP13-like protein 3 (LOC4340777), mRNA.
ACCESSION   XM_015788421
VERSION     XM_015788421.3
DBLINK      BioProject: PRJNA1123306
KEYWORDS    RefSeq; corrected model.
SOURCE      Oryza sativa Japonica Group (Japanese rice)
  ORGANISM  Oryza sativa Japonica Group
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP
            clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_089040) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jul 10, 2024 this sequence version replaced XM_015788421.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_034140825.1-RS_2024_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/21/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-198               CP132240.1         10552815-10553012
            199-937             CP132240.1         10554203-10554941
            938-938             "N"                1-1
            939-1111            CP132240.1         10554942-10555114
FEATURES             Location/Qualifiers
     source          1..1111
                     /organism="Oryza sativa Japonica Group"
                     /mol_type="mRNA"
                     /db_xref="taxon:39947"
                     /chromosome="6"
     gene            1..1111
                     /gene="LOC4340777"
                     /note="putative disease resistance RPP13-like protein 3;
                     The sequence of the model RefSeq transcript was modified
                     relative to its source genomic sequence to represent the
                     inferred CDS: inserted 1 base in 1 codon; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins, and 99% coverage of the annotated genomic
                     feature by RNAseq alignments, including 63 samples with
                     support for all annotated introns"
                     /db_xref="GeneID:4340777"
     misc_feature    1
                     /gene="LOC4340777"
                     /experiment="COORDINATES: cap analysis [ECO:0007248]"
                     /note="transcription start site"
     CDS             80..973
                     /gene="LOC4340777"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: inserted 1 base in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: putative disease resistance
                     RPP13-like protein 3"
                     /protein_id="XP_015643907.2"
                     /db_xref="GeneID:4340777"
                     /translation="
MAAETVVSMAMSVLGSAVGKAASAAADEATLLLGIQKEIWYIKDELKTIQAFLRAAEVTKKKDDLLKVWAEQVRDLSYNIEDCLDEFKVHVESQSLAKQLMKLGERHRIAVQIRNLKSRIEEVSNRNTRYSLIKPISSITTEDERDSYLEDARNQSGSNTDESELVGFAKTKDELLKLIDVNTNDGPAKVICVVGMGGLGKTTLARKAYENKEHMKNFSCCAWITVSQSFDRKEILKQMIRQLLGADSLDKLLKEFSEKLLVQVQHLADHLVEGLKEKRYFVVLDDXMDHRCMELDS"
     misc_feature    167..454
                     /gene="LOC4340777"
                     /note="Coiled-coil domain of the potato virux X resistance
                     protein and similar proteins; Region: RX-CC_like; cd14798"
                     /db_xref="CDD:271353"
     misc_feature    order(305..307,317..319,326..328,386..394,398..406,
                     410..415)
                     /gene="LOC4340777"
                     /note="RanGAP2 interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:271353"
     misc_feature    587..>937
                     /gene="LOC4340777"
                     /note="NB-ARC domain; Region: NB-ARC; pfam00931"
                     /db_xref="CDD:395745"
ORIGIN      
agttcaatacctgatacttttgctcacttggagcttgaccggagagaggggagggagagtagtgaggggggagcagtcgatggcggcggagacggtggtgagcatggcgatgtcggtgctgggcagcgccgtcgggaaggccgcctccgccgccgccgacgaggccaccctcctgctcggcatccagaaggagatctggtacatcaaggacgagctgaaaactattcaggcattcttaagagctgctgaagtaacaaagaagaaagatgacttgctaaaggtatgggcagagcaagtacgagatctgtcatataacattgaagattgcctagacgaattcaaggttcatgttgagagccaaagcttggcaaagcaactaatgaagcttggtgaacgccatcgaattgctgtacagattcgcaacttaaaatcaagaattgaagaagtgagcaacaggaatacacgctacagcttaatcaagcccatttcctctataaccacagaggatgagagggattcctacctagaagatgctcgcaatcaatcaggtagcaacactgacgagtcagaacttgtgggctttgccaagactaaagatgagttgcttaaactgatagatgtcaatactaatgacggtccagctaaagtgatatgtgtggttggtatgggtggattaggcaagactacccttgcaaggaaggcatatgaaaacaaggaacacatgaagaacttctcgtgttgtgcttggatcactgtgtctcagtcatttgacaggaaagaaattctgaaacaaatgatcaggcaacttctgggtgctgattcattagacaaactcttgaaagaatttagtgagaagttgctcgtgcaagtccagcatctcgctgatcacttggttgaagggctaaaggagaaaaggtactttgttgtccttgatgacnctatggaccatagatgcatggaattggattcatgatattgcttttccgaagattaacaacagaggtagtcgcataataataaaaacgcgagatgctggcttagctggaaggtgtacctctgaatcacttatttaccaccttgaaccgttacatatagatgatgctatacactt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]