GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-25 02:53:10, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_015786573            2222 bp    mRNA    linear   PLN 07-AUG-2018
DEFINITION  PREDICTED: Oryza sativa Japonica Group disease resistance protein
            PIK6-NP-like (LOC107281202), mRNA.
ACCESSION   XM_015786573
VERSION     XM_015786573.2
DBLINK      BioProject: PRJNA122
KEYWORDS    RefSeq.
SOURCE      Oryza sativa Japonica Group (Japanese rice)
  ORGANISM  Oryza sativa Japonica Group
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP
            clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_029261.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Aug 7, 2018 this sequence version replaced XM_015786573.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Oryza sativa Japonica Group
                                           Annotation Release 102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2222
                     /organism="Oryza sativa Japonica Group"
                     /mol_type="mRNA"
                     /cultivar="Nipponbare"
                     /db_xref="taxon:39947"
                     /chromosome="6"
     gene            1..2222
                     /gene="LOC107281202"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 25 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:107281202"
     CDS             1512..2075
                     /gene="LOC107281202"
                     /codon_start=1
                     /product="disease resistance protein PIK6-NP-like"
                     /protein_id="XP_015642059.1"
                     /db_xref="GeneID:107281202"
                     /translation="
MAETVLSMARSLVGSAISKATSAAAHEASLLLGVQKDIWYIKDELKTMQAFLRAAEVMKKKDELLKVWAEQIRDLSYDIEDCLDEFKVHIESQNLFYQMVKLRKRHLIATQIRNLKSRVEEVSSRNSRYNLVKPISSSNEDDMDCYAEDIRNQSTSNVDETELVGFSDSKIRLLELISANVIMVQPK"
     misc_feature    1542..1883
                     /gene="LOC107281202"
                     /note="Coiled-coil domain of the potato virux X resistance
                     protein and similar proteins; Region: RX-CC_like; cd14798"
                     /db_xref="CDD:271353"
     misc_feature    order(1734..1736,1746..1748,1755..1757,1797..1799,
                     1806..1808,1815..1823,1827..1835,1839..1844)
                     /gene="LOC107281202"
                     /note="RanGAP2 interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:271353"
ORIGIN      
attttatttgttgaattggcactgatactgccagttcttgctcctaggagcgcgcacgggctcaagtgaacgagtgacctctaccagtaccagtttttgtctaactcgcacttaaggatcgtgttcaatcccgagatcttttaattgtttacacctagaggcatccgccaccttttggtcgtcgccgccacctccattgtccttgttataaaatcagacccggtagcacatcgagaaataaacacagaagaaacgtcacaggagatccaaacacgatatcgccgctgaaccaagatattagtagaggtcctgaaccggctttcctccgtctgaatcggcagtcgtagccactgaatcagctttctgttcctgaaaaccatcaacgaaggaggggcagatcgatcccctttctcccatcctcgctcctcgcgctcacacggcactcctcagcacccgccactgctgccgccaacacaggagccgccgcgcatcactgctcctctgtgcccctgaggacgtcaccgccggtggccacttccgccgccgcctccttgcctcctgaacgctgccggtgagagtgccgccgctgtgggcttcccgccggtcgaggacgccgatgcccacgagtcgctccaacgcagaggaagtcgccgccctgctgtcggaacccgccgctccaccacctggagccggcgccgccaagtcgtccgccgcctgcaccgctgtttgatccgctcgacgccaaaaccatagtcgccagccgttaatagttcggcaaatttaggaggaagtttgaggctcttgtgtcgctctcacgcgggtggctcgggggcagaaccgccgctggaaaccgcgcggccggcccggaaggtagcggcggggaaaatgtgccggcggtggagttttcttctcggcgtgggaggagaaacagcgcgcgtacggcgggaggcggcggctggcggggcggatccgcctccggcaacattcgccatgcatcttcatttgtctccgcttgatgctgaccgaaggggtccctgacctaccatcaacacaaatgattgttttgtattcgtgccatgcatgacccggtccagtactgcctgcacgcggagagtgcaacgaacctcactacccacctaataggactagtaaacgagaagtcaaggtattttattgttgctcatggctttgtggaccgaattgggatattggattggtcaggtacctgagtgagtactacgctgttaatatagattgacatgaaatggaaaacagagtcctcggcgtctaaacccacctaacccatgatagactgctggtaatttaatttcaaatgtcaggggaatatgattgtctgcatgatgcgcgagtgatataaactccatgataagcatcctctctgctcagacctcagagagctcactgcaaaagctaccatttctgattcgatctggtcgccaagttctctcccctgtgcagtctttggcgaaggtgaagaatccattcaatcgatggcggagacggtgctgagcatggcgaggtcgctggtgggcagtgccatcagcaaggccacctctgcggcggcccatgaggcgagcctcctactcggcgtccagaaggacatctggtatatcaaagatgagctgaaaacaatgcaagcgttcctacgagctgctgaagttatgaagaagaaagatgagctcttaaaggtttgggcagaacagatacgtgacttgtcctatgacattgaagattgccttgacgaattcaaggtccatattgagagccaaaatctgttttatcagatggtgaagctcagaaagcgccatctgatagctacccaaatccgtaacctcaaatcaagagttgaagaagtgagtagcagaaactcacgctacaatttagtcaaacctatttcatccagcaatgaggatgacatggattgttacgcagaagacattcgtaatcagtcaactagcaatgtagatgaaactgagcttgtggggttctctgactctaagataaggttgctcgaattaatcagtgccaatgtaataatggtccaaccaaagtaatatgtgtggttgggatgggtggtttaggcaagacagctctttccaggaagatctttgaaagcaaagaggacatcggaaagaactttccatgtaatgcatggatcactgtgtcacaatcatttaacaggattgagctactcaaagata
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]