2025-07-19 08:42:00, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_015763819 870 bp mRNA linear PLN 10-JUL-2024 DEFINITION PREDICTED: Oryza sativa Japonica Group protein argonaute 3 (LOC107275377), mRNA. ACCESSION XM_015763819 VERSION XM_015763819.1 DBLINK BioProject: PRJNA1123306 KEYWORDS RefSeq; includes ab initio. SOURCE Oryza sativa Japonica Group (Japanese rice) ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_089046) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_034140825.1-RS_2024_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/21/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..870 /organism="Oryza sativa Japonica Group" /mol_type="mRNA" /db_xref="taxon:39947" /chromosome="12" gene 1..870 /gene="LOC107275377" /note="protein argonaute 3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:107275377" CDS 1..870 /gene="LOC107275377" /codon_start=1 /product="protein argonaute 3" /protein_id="XP_015619305.1" /db_xref="GeneID:107275377" /translation="
MLNGRGNTESAISSNDGNPRGCSGGEPRGYGGGGRRDGYGAGFGERSGCGGDDGGGNCRGRDVGGPKGYNSSSPRGGGGGGFGERLGCGFDDGDANPRGCIGGEPRGCGGGGPRGSGFGKRLGCGGDDSGRLRSARQMCGKKRRRGMWYCRISSQLLEEGENFVLDTQDGSDDDQIEFIPDSDDEGIEYCFSSDQEFVPETEFQDCGEVEEKGGGIQDCGEVNEKGGGIQDCGEVNEKGGGIQDCGEAKENGGEIQDCGEVEKGGGICGGSNIVHSNDECKQPAQMWCG"
ORIGIN
atgctcaacggccgcggcaacactgagagcgccatcagcagcaatgacggaaaccctaggggttgcagcggcggcgaacctaggggctatggcggtggaggccgtagggatggttacggcgctggctttggcgagagatcaggttgtggaggtgatgatggaggcggaaactgtaggggccgtgatgtcggaggccctaagggctacaacagcagcagccctaggggtggcggtggcggcggcttcggcgagagattgggatgcggcttcgacgatggcgacgcaaaccctaggggctgcatcggcggcgaacctaggggctgcggaggtggaggccctaggggcagcggcttcggcaagagattgggttgtggcggtgatgacagcggcaggttgcgaagtgccagacagatgtgcggtaagaaacggcgtcgaggcatgtggtactgtcgaatatctagccaattattggaagaaggtgagaattttgttttggatacacaagatgggtccgacgatgaccagattgagttcatccctgattctgatgatgaaggcatcgagtactgcttctcctcagatcaggagtttgtgcccgaaactgagttccaggattgtggggaagtggaggagaagggtggtgggattcaggattgtggggaggtgaacgagaagggtggtgggattcaggattgtggggaggtgaacgagaagggtggtgggattcaagattgtggggaagcgaaggagaatggtggtgagattcaggattgcggggaagtggagaagggtggtgggatttgtggcggcagcaacatagtgcactcaaatgatgaatgcaaacagcctgcccagatgtggtgcgggtag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]