LOCUS       XM_006523067            1154 bp    mRNA    linear   ROD 10-APR-2023
DEFINITION  PREDICTED: Mus musculus claudin 14 (Cldn14), transcript variant X1,
            mRNA.
ACCESSION   XM_006523067
VERSION     XM_006523067.5
DBLINK      BioProject: PRJNA169
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_000082.7) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 21, 2020 this sequence version replaced XM_006523067.4.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_000001635.27-RS_2023_04
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           RefSeqFE; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 04/05/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1154
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6J"
                     /db_xref="taxon:10090"
                     /chromosome="16"
     gene            1..1154
                     /gene="Cldn14"
                     /note="claudin 14; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 mRNAs, 5 ESTs, 1 long
                     SRA read, 11 Proteins, and 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 7 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:56173"
                     /db_xref="MGI:MGI:1860425"
     CDS             229..948
                     /gene="Cldn14"
                     /codon_start=1
                     /product="claudin-14 isoform X1"
                     /protein_id="XP_006523130.1"
                     /db_xref="GeneID:56173"
                     /db_xref="MGI:MGI:1860425"
                     /translation="

MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV"

     misc_feature    295..771
                     /gene="Cldn14"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      

gtaattgaccagacaactctctctcaaacacactggccttagagcttccattcggcgaatgaggcaaagccagaagactgtggtgtccttgctgtgtctccgtggtctacctgagagcatcaaggtggatgggactggagctgttctgcttcctgcgggcacctaaggaccagatccatccctggggacctgggcactgctcagcgcggctagcaggggcccttagccatggccagcacagcggtccagctcctaggcttcctgcttagcttcctgggcatggtaggaacgctcatcaccaccatcctgccacactggcggaggacggcccatgtgggcaccaacatcctgactgccgtatcctacctgaagggactgtggatggaatgtgtgtggcacagcacaggcatctaccagtgtcagatctaccgctcactgctggcgctgccccgggacttgcaggccgcccgggcgctcatggtcatctcctgcctgttgtcgggcatggcctgcgcctgcgcagtagtgggcatgaagtgcacacgctgcgccaaaggcacacccgccaagaccacctttgcagtgctggggggcgcgctcttcctgctggccggcctgctgtgcatggtggccgtgtcctggaccacgaatgacgtggtgcagaatttttataacccgctgctgcccagtggcatgaagtttgaaatcggccaggccctgtacctgggcttcatctcctcatccctgtctctcatcgggggcaccctgctctgcttatcctgccaggacgaggccccctacagaccctacccgccccagtccagggccggagctaccaccacggctaccgcccctgcctaccgcccaccagcggcctacaaggacaaccgtgccccctcggtgacctcagccgcgcacagtgggtacaggctgaatgactacgtgtgagttccttccccgggcttctgccagggatgctgggccccaaaggaccaatgatggatgtgggaaggatgcagagagcaagcccggaacacagggaaggaggtgctcttcaaagcaaagacttctaaaaagtgctggttttttatttattatatgtatttatgcgggtggcttaataagagctcaataaagagtgtcttggaagcgtg

//