GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-06 16:58:11, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_178245                875 bp    mRNA    linear   ROD 06-AUG-2023
DEFINITION  Mus musculus brain specific homeobox (Bsx), mRNA.
ACCESSION   NM_178245
VERSION     NM_178245.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 875)
  AUTHORS   Magno L, Asgarian Z, Apanaviciute M, Milner Y, Bengoa-Vergniory N,
            Rubin AN and Kessaris N.
  TITLE     Fate mapping reveals mixed embryonic origin and unique
            developmental codes of mouse forebrain septal neurons
  JOURNAL   Commun Biol 5 (1), 1137 (2022)
   PUBMED   36302841
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 875)
  AUTHORS   Newman EA, Wu D, Taketo MM, Zhang J and Blackshaw S.
  TITLE     Canonical Wnt signaling regulates patterning, differentiation and
            nucleogenesis in mouse hypothalamus and prethalamus
  JOURNAL   Dev Biol 442 (2), 236-248 (2018)
   PUBMED   30063881
REFERENCE   3  (bases 1 to 875)
  AUTHORS   Lee B, Kim J, An T, Kim S, Patel EM, Raber J, Lee SK, Lee S and Lee
            JW.
  TITLE     Dlx1/2 and Otp coordinate the production of hypothalamic GHRH- and
            AgRP-neurons
  JOURNAL   Nat Commun 9 (1), 2026 (2018)
   PUBMED   29795232
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 875)
  AUTHORS   Lee B, Lee S, Lee SK and Lee JW.
  TITLE     The LIM-homeobox transcription factor Isl1 plays crucial roles in
            the development of multiple arcuate nucleus neurons
  JOURNAL   Development 143 (20), 3763-3773 (2016)
   PUBMED   27578785
REFERENCE   5  (bases 1 to 875)
  AUTHORS   Sokolowski K, Tran T, Esumi S, Kamal Y, Oboti L, Lischinsky J,
            Goodrich M, Lam A, Carter M, Nakagawa Y and Corbin JG.
  TITLE     Molecular and behavioral profiling of Dbx1-derived neurons in the
            arcuate, lateral and ventromedial hypothalamic nuclei
  JOURNAL   Neural Dev 11 (1), 12 (2016)
   PUBMED   27209204
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 875)
  AUTHORS   Park SY, Kim JB and Han YM.
  TITLE     REST is a key regulator in brain-specific homeobox gene expression
            during neuronal differentiation
  JOURNAL   J Neurochem 103 (6), 2565-2574 (2007)
   PUBMED   17944879
  REMARK    GeneRIF: binding of REST to neuron restrictive silencer element
            suppresses transcriptional activator Sp1-mediated activation of bsx
            in non-neuronal cells
REFERENCE   7  (bases 1 to 875)
  AUTHORS   McArthur T and Ohtoshi A.
  TITLE     A brain-specific homeobox gene, Bsx, is essential for proper
            postnatal growth and nursing
  JOURNAL   Mol Cell Biol 27 (14), 5120-5127 (2007)
   PUBMED   17485440
  REMARK    GeneRIF: These results demonstrate that Bsx is required for
            postnatal growth and maintenance of lactating mammary glands.
REFERENCE   8  (bases 1 to 875)
  AUTHORS   Sakkou M, Wiedmer P, Anlag K, Hamm A, Seuntjens E, Ettwiller L,
            Tschop MH and Treier M.
  TITLE     A role for brain-specific homeobox factor Bsx in the control of
            hyperphagia and locomotory behavior
  JOURNAL   Cell Metab 5 (6), 450-463 (2007)
   PUBMED   17550780
REFERENCE   9  (bases 1 to 875)
  AUTHORS   Chu HY and Ohtoshi A.
  TITLE     Cloning and functional analysis of hypothalamic homeobox gene Bsx1a
            and its isoform, Bsx1b
  JOURNAL   Mol Cell Biol 27 (10), 3743-3749 (2007)
   PUBMED   17353277
  REMARK    GeneRIF: Data demonstrate that BSX1A is a DNA binding protein and a
            transcriptional activator, and that BSX1A and BSX1B localize in the
            nuclei and cytoplasm, respectively.
REFERENCE   10 (bases 1 to 875)
  AUTHORS   Cremona M, Colombo E, Andreazzoli M, Cossu G and Broccoli V.
  TITLE     Bsx, an evolutionary conserved Brain Specific homeoboX gene
            expressed in the septum, epiphysis, mammillary bodies and arcuate
            nucleus
  JOURNAL   Gene Expr Patterns 4 (1), 47-51 (2004)
   PUBMED   14678827
  REMARK    GeneRIF: Might be considered an important molecular marker for
            early embryonic stages of epiphysis development.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AC158355.2.
            
            On Nov 17, 2006 this sequence version replaced NM_178245.2.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY233396.1, BC104387.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849378, SAMN01164137
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-313               AC158355.2         163549-163861
            314-510             AC158355.2         165716-165912
            511-875             AC158355.2         167030-167394
FEATURES             Location/Qualifiers
     source          1..875
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="9"
                     /map="9 21.65 cM"
     gene            1..875
                     /gene="Bsx"
                     /gene_synonym="Bsx1a; Bsx1b"
                     /note="brain specific homeobox"
                     /db_xref="GeneID:244813"
                     /db_xref="MGI:MGI:2669849"
     exon            1..313
                     /gene="Bsx"
                     /gene_synonym="Bsx1a; Bsx1b"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    34..36
                     /gene="Bsx"
                     /gene_synonym="Bsx1a; Bsx1b"
                     /note="upstream in-frame stop codon"
     CDS             52..750
                     /gene="Bsx"
                     /gene_synonym="Bsx1a; Bsx1b"
                     /codon_start=1
                     /product="brain-specific homeobox protein homolog"
                     /protein_id="NP_839976.1"
                     /db_xref="CCDS:CCDS23084.1"
                     /db_xref="GeneID:244813"
                     /db_xref="MGI:MGI:2669849"
                     /translation="
MNLNFTSPLHPASSQRPTSFFIEDILLHKPKPLREVAPDHFASSLASRVPLLDYGYPLMPTPTLLTPHAHHPLHKGDHHHPYFLTTSGMPVPALFPHPQHAELPGKHCRRRKARTVFSDSQLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMKHKKQLRKSQDEPKAADGPESPEGSPRAPEGAPADARLSLPAGAFVLTEPEDEVDIGDEGELSSGPHVL"
     misc_feature    order(382..396,400..402,451..453,469..471,508..510,
                     514..519,526..531,535..543,547..552)
                     /gene="Bsx"
                     /gene_synonym="Bsx1a; Bsx1b"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(388..390,397..399,517..519,526..531,538..540)
                     /gene="Bsx"
                     /gene_synonym="Bsx1a; Bsx1b"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    391..549
                     /gene="Bsx"
                     /gene_synonym="Bsx1a; Bsx1b"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    529..747
                     /gene="Bsx"
                     /gene_synonym="Bsx1a; Bsx1b"
                     /note="propagated from UniProtKB/Swiss-Prot (Q810B3.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            314..510
                     /gene="Bsx"
                     /gene_synonym="Bsx1a; Bsx1b"
                     /inference="alignment:Splign:2.1.0"
     exon            511..875
                     /gene="Bsx"
                     /gene_synonym="Bsx1a; Bsx1b"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
tgcttcctgcactttgtccgggccctcgccctgtgacaggcgctctgcaagatgaatctcaacttcacttcccctcttcatccagcatcttctcagaggcccacgtcgtttttcatcgaggacattctgctacacaagcccaagccgttgagggaagtggcccctgaccactttgccagctctctggcctctagggtgcctttgctagactatggctacccccttatgcccacacccaccctcctcacccctcacgctcatcatcctctgcataagggagatcaccaccatccttatttcctgaccacctcagggatgccggtcccggcgctgttcccgcacccgcagcacgcggagttgcccgggaagcactgccgccgccgcaaagctcgcacggtgttttctgactcgcagctctccggcctggagaaaaggttcgaaatccagcgctacctgtcgacgccagagcgtgtggagctggccactgccctcagcctctcagagactcaggtgaaaacgtggttccagaaccggcggatgaagcataaaaagcagctgaggaaaagccaagacgaaccgaaagcggcagacgggccggagagccccgaaggcagccctcgtgctcccgagggcgcgcccgccgacgctcggctgagcctgcccgccggtgccttcgtgcttactgagcccgaggacgaagtggacattggggatgaaggcgagctcagctcagggccgcatgtgctctgagtggccaggctgggaagggagacccgggcgaggaggccgcggggccagaccgggttcttcccgggtgggaagactcgcggagactccagactgctcctgcgacctgggctggaagaaagaaaggc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]