LOCUS       NM_078484               1434 bp    mRNA    linear   ROD 21-JUN-2025
DEFINITION  Mus musculus solute carrier family 35 (UDP-galactose transporter),
            member A2 (Slc35a2), transcript variant 1, mRNA.
ACCESSION   NM_078484
VERSION     NM_078484.3
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1434)
  AUTHORS   Elziny,S., Sran,S., Yoon,H., Corrigan,R.R., Page,J., Ringland,A.,
            Lanier,A., Lapidus,S., Foreman,J., Heinzen,E.L., Iffland,P.,
            Crino,P.B. and Bedrosian,T.A.
  TITLE     Loss of Slc35a2 alters development of the mouse cerebral cortex
  JOURNAL   Neurosci Lett 836, 137881 (2024)
   PUBMED   38909838
  REMARK    GeneRIF: Loss of Slc35a2 alters development of the mouse cerebral
            cortex.
REFERENCE   2  (bases 1 to 1434)
  AUTHORS   Cheng,H., Wang,S., Gao,D., Yu,K., Chen,H., Huang,Y., Li,M.,
            Zhang,J. and Guo,K.
  TITLE     Nucleotide sugar transporter SLC35A2 is involved in promoting
            hepatocellular carcinoma metastasis by regulating cellular
            glycosylation
  JOURNAL   Cell Oncol (Dordr) 46 (2), 283-297 (2023)
   PUBMED   36454514
  REMARK    GeneRIF: Nucleotide sugar transporter SLC35A2 is involved in
            promoting hepatocellular carcinoma metastasis by regulating
            cellular glycosylation.
REFERENCE   3  (bases 1 to 1434)
  AUTHORS   Hayashi,Y., Ito,Y., Yanagiba,Y., Kamijima,M., Naito,H. and
            Nakajima,T.
  TITLE     Differences in metabolite burden of di(2-ethylhexyl)phthalate in
            pregnant and postpartum dams and their offspring in relation to
            drug-metabolizing enzymes in mice
  JOURNAL   Arch Toxicol 86 (4), 563-569 (2012)
   PUBMED   22159897
  REMARK    GeneRIF: DEHP exposure did not influence lipase activity, whereas
            it slightly enhanced UGT activity and exclusively increased CYP4A14
            levels in pregnant and/or postpartum dams.
REFERENCE   4  (bases 1 to 1434)
  AUTHORS   Oelmann,S., Stanley,P. and Gerardy-Schahn,R.
  TITLE     Point mutations identified in Lec8 Chinese hamster ovary
            glycosylation mutants that inactivate both the UDP-galactose and
            CMP-sialic acid transporters
  JOURNAL   J Biol Chem 276 (28), 26291-26300 (2001)
   PUBMED   11319223
REFERENCE   5  (bases 1 to 1434)
  AUTHORS   Means,G.D., Toy,D.Y., Baum,P.R. and Derry,J.M.
  TITLE     A transcript map of a 2-Mb BAC contig in the proximal portion of
            the mouse X chromosome and regional mapping of the scurfy mutation
  JOURNAL   Genomics 65 (3), 213-223 (2000)
   PUBMED   10857745
REFERENCE   6  (bases 1 to 1434)
  AUTHORS   Ishida,N., Yoshioka,S., Iida,M., Sudo,K., Miura,N., Aoki,K. and
            Kawakita,M.
  TITLE     Indispensability of transmembrane domains of Golgi UDP-galactose
            transporter as revealed by analysis of genetic defects in
            UDP-galactose transporter-deficient murine had-1 mutant cell lines
            and construction of deletion mutants
  JOURNAL   J Biochem 126 (6), 1107-1117 (1999)
   PUBMED   10578063
REFERENCE   7  (bases 1 to 1434)
  AUTHORS   Ishida,N., Miura,N., Yoshioka,S. and Kawakita,M.
  TITLE     Molecular cloning and characterization of a novel isoform of the
            human UDP-galactose transporter, and of related complementary DNAs
            belonging to the nucleotide-sugar transporter gene family
  JOURNAL   J Biochem 120 (6), 1074-1078 (1996)
   PUBMED   9010752
REFERENCE   8  (bases 1 to 1434)
  AUTHORS   Lennon,G., Auffray,C., Polymeropoulos,M. and Soares,M.B.
  TITLE     The I.M.A.G.E. Consortium: an integrated molecular analysis of
            genomes and their expression
  JOURNAL   Genomics 33 (1), 151-152 (1996)
   PUBMED   8617505
REFERENCE   9  (bases 1 to 1434)
  AUTHORS   Hara,T., Yamauchi,M., Takahashi,E., Hoshino,M., Aoki,K., Ayusawa,D.
            and Kawakita,M.
  TITLE     The UDP-galactose translocator gene is mapped to band
            Xp11.23-p11.22 containing the Wiskott-Aldrich syndrome locus
  JOURNAL   Somat Cell Mol Genet 19 (6), 571-575 (1993)
   PUBMED   8128316
REFERENCE   10 (bases 1 to 1434)
  AUTHORS   Hara,T., Hattori,S. and Kawakita,M.
  TITLE     Isolation and characterization of mouse FM3A cell mutants which are
            devoid of Newcastle disease virus receptors
  JOURNAL   J Virol 63 (1), 182-188 (1989)
   PUBMED   2535724
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL671978.2.
            
            On Dec 5, 2023 this sequence version replaced NM_078484.2.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR5189673.168008.1, AF229634.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849375
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-101               AL671978.2         40630-40730
            102-284             AL671978.2         42046-42228
            285-436             AL671978.2         45909-46060
            437-1164            AL671978.2         48437-49164
            1165-1434           AL671978.2         50488-50757
FEATURES             Location/Qualifiers
     source          1..1434
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 3.56 cM"
     gene            1..1434
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /note="solute carrier family 35 (UDP-galactose
                     transporter), member A2"
                     /db_xref="GeneID:22232"
                     /db_xref="MGI:MGI:1345297"
     exon            1..101
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /inference="alignment:Splign:2.1.0"
     CDS             11..1192
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /note="isoform 1 is encoded by transcript variant 1;
                     solute carrier family 35 (UDP-galactose transporter)
                     member 2; mUGT1; UDP-Gal-Tr; solute carrier family 35
                     member A2; solute carrier family 35 (UDP-galactose
                     transporter), member 2; UDP-galactose translocator; solute
                     carrier family (UDP-N-acetylglucosamine transporter),
                     member 2"
                     /codon_start=1
                     /product="UDP-galactose translocator isoform 1"
                     /protein_id="NP_511039.2"
                     /db_xref="CCDS:CCDS52986.1"
                     /db_xref="GeneID:22232"
                     /db_xref="MGI:MGI:1345297"
                     /translation="

MAAVGVGGSTAAAGAGAVSSGALEPGSTTAAHRRLKYISLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGSGPRPLDQNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVASQGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHLDPLFALGAGLVIGAVYLYSLPRGAVKAIASASASGPCIHQQPPGQPPPPQLSSRGDLTTEPFLPKLLTKVKGS"

     misc_feature    11..82
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9R0M8.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    17..79
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9R0M8.1);
                     transmembrane region"
     misc_feature    101..1027
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /note="Nucleotide-sugar transporter; Region:
                     Nuc_sug_transp; pfam04142"
                     /db_xref="CDD:398009"
     misc_feature    119..181
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9R0M8.1);
                     transmembrane region"
     misc_feature    203..265
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9R0M8.1);
                     transmembrane region"
     misc_feature    299..361
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9R0M8.1);
                     transmembrane region"
     misc_feature    428..490
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9R0M8.1);
                     transmembrane region"
     misc_feature    515..577
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9R0M8.1);
                     transmembrane region"
     misc_feature    608..670
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9R0M8.1);
                     transmembrane region"
     misc_feature    722..784
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9R0M8.1);
                     transmembrane region"
     misc_feature    815..877
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9R0M8.1);
                     transmembrane region"
     misc_feature    953..1015
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9R0M8.1);
                     transmembrane region"
     exon            102..284
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /inference="alignment:Splign:2.1.0"
     exon            285..436
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /inference="alignment:Splign:2.1.0"
     exon            437..1164
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /inference="alignment:Splign:2.1.0"
     exon            1165..1434
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1414..1419
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /note="hexamer: AATAAA"
     polyA_site      1434
                     /gene="Slc35a2"
                     /gene_synonym="Had-1; Had1; Sfc8; Ugalt; UGT"
                     /note="major polyA site"
ORIGIN      

agatgccaacatggcagcggttggggttggtggatctaccgctgcggccggggctggggctgtgtcctcgggcgcgttggaacctgggtccactacagcggctcaccggcgcctcaagtatatatccttagctgtgctggtggtccagaatgcctccctcatcctcagcatccgctacgctcgcacactgcctggggaccgcttctttgccaccactgctgtggtcatggctgaagtgctcaaaggtctcacctgtctcctgctgctcttcgcacaaaagaggggtaatgtgaagcacctggtcctcttcctccatgaggctgtcctggtccaatatgtggacacactcaagcttgcggtgccctctctcatctataccttgcagaataacctccagtatgttgccatcagcaacctgccagctgccactttccaggtgacatatcagctgaagatcctgactacagcgctcttctctgtgctcatgttgaatcgcagcctctcacgcctgcagtgggcctctctgctgctgctcttcactggtgtcgccattgtccaggcacagcaagctggtgggagtggcccacggccactggatcagaacccgggggcgggcttagcggcagttgtggcctcctgtctctcctcaggcttcgctggggtctactttgagaagatcctcaaaggcagctcaggttctgtgtggcttcgtaacctacagctcggcctctttggcacagcgctgggcctggtggggctctggtgggctgagggcaccgccgtggccagtcaaggcttcttctttgggtacacacctgctgtctggggtgtagtactaaaccaagcctttggtgggcttctggtggctgttgttgtcaagtatgctgacaacatcctcaagggctttgccacctccctgtctattgtgctgtccactgttgcctccattcgcctctttggcttccacctggacccattatttgccctgggcgctgggctcgtcattggtgctgtctacctctacagccttccccgaggtgcagtcaaagccatagcctcggcctcggcctctgggccctgcattcaccagcagcctcctgggcagccaccaccaccgcagctgtcttctcgaggagacctcaccacggagccctttctgccaaagttgctcaccaaggtgaaggggtcgtagctgctggacttgaagatgctggcctgtcttcgttctcccttcttgccctggcccaactgggactaaactcttatcagtattaggggtagggtgaggtagacacgggaactccctgtccttaccaacccctgccccacatagggctgacatgactaacctctgttaatgggcccacctctactcctgctatctttacagtatttcttaggtgagtttctgcaaataaaatgttttgcaccttg

//