GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-07 00:45:20, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_029636               1330 bp    mRNA    linear   ROD 26-MAY-2023
DEFINITION  Mus musculus cathepsin Q (Ctsq), mRNA.
ACCESSION   NM_029636
VERSION     NM_029636.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1330)
  AUTHORS   Astrof S, Arriagada C, Saijoh Y, Francou A, Kelly RG and Moon A.
  TITLE     Aberrant differentiation of second heart field mesoderm prefigures
            cellular defects in the outflow tract in response to loss of FGF8
  JOURNAL   Dev Biol 499, 10-21 (2023)
   PUBMED   37060937
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 1330)
  AUTHORS   Lee JG, Kim G, Park SG, Yon JM, Yeom J, Song HE, Cheong SA, Lim JS,
            Sung YH, Kim K, Yoo HJ, Hong EJ, Nam KH, Seong JK, Kim CJ, Nam SY
            and Baek IJ.
  TITLE     Lipid signatures reflect the function of the murine primary
            placentationdagger
  JOURNAL   Biol Reprod 106 (3), 583-596 (2022)
   PUBMED   34850819
REFERENCE   3  (bases 1 to 1330)
  AUTHORS   Torregrosa-Carrion R, Pineiro-Sabaris R, Siguero-Alvarez M,
            Grego-Bessa J, Luna-Zurita L, Fernandes VS, MacGrogan D, Stainier
            DYR and de la Pompa JL.
  TITLE     Adhesion G protein-coupled receptor Gpr126/Adgrg6 is essential for
            placental development
  JOURNAL   Sci Adv 7 (46), eabj5445 (2021)
   PUBMED   34767447
REFERENCE   4  (bases 1 to 1330)
  AUTHORS   Li F, Xu R, Lin CL, Low BE, Cai L, Li S, Ji P, Huang L, Wiles MV,
            Hannun YA, Obeid LM, Chen Y and Mao C.
  TITLE     Maternal and fetal alkaline ceramidase 2 is required for placental
            vascular integrity in mice
  JOURNAL   FASEB J 34 (11), 15252-15268 (2020)
   PUBMED   32959379
REFERENCE   5  (bases 1 to 1330)
  AUTHORS   Vrooman LA, Rhon-Calderon EA, Chao OY, Nguyen DK, Narapareddy L,
            Dahiya AK, Putt ME, Schultz RM and Bartolomei MS.
  TITLE     Assisted reproductive technologies induce temporally specific
            placental defects and the preeclampsia risk marker sFLT1 in mouse
  JOURNAL   Development 147 (11) (2020)
   PUBMED   32471820
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1330)
  AUTHORS   Simmons DG, Fortier AL and Cross JC.
  TITLE     Diverse subtypes and developmental origins of trophoblast giant
            cells in the mouse placenta
  JOURNAL   Dev Biol 304 (2), 567-578 (2007)
   PUBMED   17289015
REFERENCE   7  (bases 1 to 1330)
  AUTHORS   Liu P, Wang Y, Vikis H, Maciag A, Wang D, Lu Y, Liu Y and You M.
  TITLE     Candidate lung tumor susceptibility genes identified through
            whole-genome association analyses in inbred mice
  JOURNAL   Nat Genet 38 (8), 888-895 (2006)
   PUBMED   16862160
REFERENCE   8  (bases 1 to 1330)
  AUTHORS   Ishida M, Ono K, Taguchi S, Ohashi S, Naito J, Horiguchi K and
            Harigaya T.
  TITLE     Cathepsin gene expression in mouse placenta during the latter half
            of pregnancy
  JOURNAL   J Reprod Dev 50 (5), 515-523 (2004)
   PUBMED   15514457
  REMARK    GeneRIF: Possible association of cathepsins with placental
            lactogen-II may play important roles in placental functions during
            the latter half of pregnancy in mice.
REFERENCE   9  (bases 1 to 1330)
  AUTHORS   Deussing J, Kouadio M, Rehman S, Werber I, Schwinde A and Peters C.
  TITLE     Identification and characterization of a dense cluster of
            placenta-specific cysteine peptidase genes and related genes on
            mouse chromosome 13
  JOURNAL   Genomics 79 (2), 225-240 (2002)
   PUBMED   11829493
REFERENCE   10 (bases 1 to 1330)
  AUTHORS   Sol-Church K, Frenck J and Mason RW.
  TITLE     Cathepsin Q, a novel lysosomal cysteine protease highly expressed
            in placenta
  JOURNAL   Biochem Biophys Res Commun 267 (3), 791-795 (2000)
   PUBMED   10673370
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AC160115.2.
            
            On Mar 21, 2007 this sequence version replaced NM_029636.2.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY014776.1, BC099415.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164134 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-33                AC160115.2         36727-36759         c
            34-167              AC160115.2         35589-35722         c
            168-290             AC160115.2         35191-35313         c
            291-470             AC160115.2         34922-35101         c
            471-695             AC160115.2         33834-34058         c
            696-858             AC160115.2         33216-33378         c
            859-973             AC160115.2         32337-32451         c
            974-1330            AC160115.2         31200-31556         c
FEATURES             Location/Qualifiers
     source          1..1330
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="13"
                     /map="13 32.65 cM"
     gene            1..1330
                     /gene="Ctsq"
                     /gene_synonym="1600010J02Rik"
                     /note="cathepsin Q"
                     /db_xref="GeneID:104002"
                     /db_xref="MGI:MGI:2137385"
     exon            1..33
                     /gene="Ctsq"
                     /gene_synonym="1600010J02Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            34..167
                     /gene="Ctsq"
                     /gene_synonym="1600010J02Rik"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    36..38
                     /gene="Ctsq"
                     /gene_synonym="1600010J02Rik"
                     /note="upstream in-frame stop codon"
     CDS             42..1073
                     /gene="Ctsq"
                     /gene_synonym="1600010J02Rik"
                     /codon_start=1
                     /product="cathepsin Q precursor"
                     /protein_id="NP_083912.2"
                     /db_xref="CCDS:CCDS26584.1"
                     /db_xref="GeneID:104002"
                     /db_xref="MGI:MGI:2137385"
                     /translation="
MTPAFFLVILCLGILSGVSAFDPSLDVEWKEWMGSFEKLYSPEEEVLRRAIWEENVKRIKLHNRENSLGKNTYTMGLNGFADMTDEEFMNIVIGATLPVDNTRKSLWKRALGSPFPKSWYWKDALPKFVDWRNEGYVTRVRNQRNCNSCWAFPVTGAIEGQMFKKTGKLIPLSVQNLVDCSRPQGNRGCRWGNTYNGFQYVLHNGGLEAQATYPYEGKEGLCRYNPKNSAAKITGFVVLPESEDVLMDAVATKGPIATGIHVVSSSFRFYDGGVYYEPNCTSSVNHAVLIIGYGYVGNETDGNNYWLIKNSWGRRWGLSGYMMIAKDRNNHCAIASLAQYPTV"
     sig_peptide     42..101
                     /gene="Ctsq"
                     /gene_synonym="1600010J02Rik"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    126..302
                     /gene="Ctsq"
                     /gene_synonym="1600010J02Rik"
                     /note="Cathepsin propeptide inhibitor domain (I29);
                     Region: Inhibitor_I29; smart00848"
                     /db_xref="CDD:214853"
     misc_feature    414..1067
                     /gene="Ctsq"
                     /gene_synonym="1600010J02Rik"
                     /note="Papain family cysteine protease; Region:
                     Peptidase_C1; pfam00112"
                     /db_xref="CDD:425470"
     misc_feature    order(468..470,486..488,897..899,969..971)
                     /gene="Ctsq"
                     /gene_synonym="1600010J02Rik"
                     /note="active site"
                     /db_xref="CDD:239068"
     misc_feature    order(618..623,816..818,891..893,900..902,1050..1052)
                     /gene="Ctsq"
                     /gene_synonym="1600010J02Rik"
                     /note="S2 subsite [active]"
                     /db_xref="CDD:239068"
     exon            168..290
                     /gene="Ctsq"
                     /gene_synonym="1600010J02Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            291..470
                     /gene="Ctsq"
                     /gene_synonym="1600010J02Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            471..695
                     /gene="Ctsq"
                     /gene_synonym="1600010J02Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            696..858
                     /gene="Ctsq"
                     /gene_synonym="1600010J02Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            859..973
                     /gene="Ctsq"
                     /gene_synonym="1600010J02Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            974..1330
                     /gene="Ctsq"
                     /gene_synonym="1600010J02Rik"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gtgatctgaggcagtagtggtcatcccagaaaggttgagacatgactcctgctttcttcctggtcatcctgtgcttgggaatcctgtcaggtgtttcagcatttgatcccagtttggatgtcgaatggaaagagtggatgggaagctttgaaaaattatacagtccggaggaagaagtactgagaagagcaatatgggaagaaaatgtaaaaaggattaaactgcataacagggagaattccctagggaagaatacctacaccatgggattaaatgggtttgctgacatgactgatgaagaattcatgaacattgtaattggtgctacattgccagttgacaacacaagaaaaagtctctggaaacgtgcacttggtagtccttttcctaaatcttggtattggaaagatgctttgcccaaatttgttgattggcgaaatgaaggctatgtgactcgtgtgaggaatcagagaaattgtaattcttgttgggcttttcctgtgactggtgccatagaaggacaaatgttcaagaaaacaggcaaactgatcccactgagtgtacagaacctagtggactgttctaggcctcaaggcaatagaggctgtcgttggggtaatacatacaatggattccagtacgttttgcacaatggaggtctggaggctcaggcaacctatccttatgaaggaaaagaaggactatgcaggtacaatcctaaaaattctgctgctaaaatcacaggatttgtggtcctcccagaaagtgaagatgtcctcatggatgctgtagcaactaaaggccccattgctactggaattcatgttgtctccagtagttttaggttctatgatggaggtgtttattatgaaccaaattgcacaagttctgtgaatcatgcagttttgataattggctatggttatgtgggaaatgaaacggatggcaataattactggctgatcaagaacagctggggtagacgatggggattgagtggatatatgatgattgccaaagacaggaacaaccactgtgcaattgcttcattggcccaataccctactgtgtgagcaccctgatgttcacaagaaagcatgtggcatgagactctatttccagaggagtgccatccactccaatgaacagactttattgactatgttaaactcttgagtcccacaaaatccacattgtaatgtgaattctgggagctttcaaatatttcacatgagtactgtaacttttgctttcactactgaatgctcatgttttctaaagtaactttattttcacttttaatgtttgtgcaaataaaatccttaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]