2024-05-07 06:23:22, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_026509 2062 bp mRNA linear ROD 05-AUG-2023 DEFINITION Mus musculus caveolae associated 4 (Cavin4), mRNA. ACCESSION NM_026509 VERSION NM_026509.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 2062) AUTHORS Lo HP, Lim YW, Xiong Z, Martel N, Ferguson C, Ariotti N, Giacomotto J, Rae J, Floetenmeyer M, Moradi SV, Gao Y, Tillu VA, Xia D, Wang H, Rahnama S, Nixon SJ, Bastiani M, Day RD, Smith KA, Palpant NJ, Johnston WA, Alexandrov K, Collins BM, Hall TE and Parton RG. TITLE Cavin4 interacts with Bin1 to promote T-tubule formation and stability in developing skeletal muscle JOURNAL J Cell Biol 220 (12) (2021) PUBMED 34633413 REMARK GeneRIF: Cavin4 interacts with Bin1 to promote T-tubule formation and stability in developing skeletal muscle. REFERENCE 2 (bases 1 to 2062) AUTHORS Nishi M, Ogata T, Cannistraci CV, Ciucci S, Nakanishi N, Higuchi Y, Sakamoto A, Tsuji Y, Mizushima K and Matoba S. TITLE Systems Network Genomic Analysis Reveals Cardioprotective Effect of MURC/Cavin-4 Deletion Against Ischemia/Reperfusion Injury JOURNAL J Am Heart Assoc 8 (15), e012047 (2019) PUBMED 31364493 REMARK GeneRIF: Systems Network Genomic Analysis Reveals Cardioprotective Effect of MURC/Cavin-4 Deletion Against Ischemia/Reperfusion Injury. REFERENCE 3 (bases 1 to 2062) AUTHORS Miyagawa K, Ogata T, Ueyama T, Kasahara T, Nakanishi N, Naito D, Taniguchi T, Hamaoka T, Maruyama N, Nishi M, Kimura T, Yamada H, Aoki H and Matoba S. TITLE Loss of MURC/Cavin-4 induces JNK and MMP-9 activity enhancement in vascular smooth muscle cells and exacerbates abdominal aortic aneurysm JOURNAL Biochem Biophys Res Commun 487 (3), 587-593 (2017) PUBMED 28433630 REMARK GeneRIF: The MURC/Cavin-4 in vascular smooth muscle cells modulates abdominal aortic aneurysm (AAA) progression at the early stage via the activation of JNK and MMP-9. MURC/Cavin-4 is a potential therapeutic target against AAA progression. REFERENCE 4 (bases 1 to 2062) AUTHORS Bang ML. TITLE Animal Models of Congenital Cardiomyopathies Associated With Mutations in Z-Line Proteins JOURNAL J Cell Physiol 232 (1), 38-52 (2017) PUBMED 27171814 REMARK Review article REFERENCE 5 (bases 1 to 2062) AUTHORS Nakanishi N, Ogata T, Naito D, Miyagawa K, Taniguchi T, Hamaoka T, Maruyama N, Kasahara T, Nishi M, Matoba S and Ueyama T. TITLE MURC deficiency in smooth muscle attenuates pulmonary hypertension JOURNAL Nat Commun 7, 12417 (2016) PUBMED 27546070 REMARK GeneRIF: MURC binds to Cav1 and inhibits the association of Cav1 with the active form of Galpha13, resulting in the facilitated association of the active form of Galpha13 with p115RhoGEF. These results reveal that MURC has a function in the development of pulmonary hypertension through modulating Rho/ROCK signaling. Publication Status: Online-Only REFERENCE 6 (bases 1 to 2062) AUTHORS Ogata T, Naito D, Nakanishi N, Hayashi YK, Taniguchi T, Miyagawa K, Hamaoka T, Maruyama N, Matoba S, Ikeda K, Yamada H, Oh H and Ueyama T. TITLE MURC/Cavin-4 facilitates recruitment of ERK to caveolae and concentric cardiac hypertrophy induced by alpha1-adrenergic receptors JOURNAL Proc Natl Acad Sci U S A 111 (10), 3811-3816 (2014) PUBMED 24567387 REMARK GeneRIF: MURC/Cavin-4 facilitates recruitment of ERK to caveolae and concentric cardiac hypertrophy induced by alpha1-adrenergic receptors. REFERENCE 7 (bases 1 to 2062) AUTHORS Ludwig A, Howard G, Mendoza-Topaz C, Deerinck T, Mackey M, Sandin S, Ellisman MH and Nichols BJ. TITLE Molecular composition and ultrastructure of the caveolar coat complex JOURNAL PLoS Biol 11 (8), e1001640 (2013) PUBMED 24013648 REFERENCE 8 (bases 1 to 2062) AUTHORS Bastiani M, Liu L, Hill MM, Jedrychowski MP, Nixon SJ, Lo HP, Abankwa D, Luetterforst R, Fernandez-Rojo M, Breen MR, Gygi SP, Vinten J, Walser PJ, North KN, Hancock JF, Pilch PF and Parton RG. TITLE MURC/Cavin-4 and cavin family members form tissue-specific caveolar complexes JOURNAL J Cell Biol 185 (7), 1259-1273 (2009) PUBMED 19546242 REMARK GeneRIF: Data show that MURC/Cavin-4 forms a multiprotein complex that associates with caveolae, and identify Cavin-4 as a novel muscle disease candidate caveolar protein. REFERENCE 9 (bases 1 to 2062) AUTHORS Tagawa M, Ueyama T, Ogata T, Takehara N, Nakajima N, Isodono K, Asada S, Takahashi T, Matsubara H and Oh H. TITLE MURC, a muscle-restricted coiled-coil protein, is involved in the regulation of skeletal myogenesis JOURNAL Am J Physiol Cell Physiol 295 (2), C490-C498 (2008) PUBMED 18508909 REMARK GeneRIF: findings suggest that MURC is involved in the skeletal myogenesis that results from modulation of myogenin expression and ERK activation; MURC may play pivotal roles in the molecular mechanisms of skeletal myogenic differentiation REFERENCE 10 (bases 1 to 2062) AUTHORS Ogata T, Ueyama T, Isodono K, Tagawa M, Takehara N, Kawashima T, Harada K, Takahashi T, Shioi T, Matsubara H and Oh H. TITLE MURC, a muscle-restricted coiled-coil protein that modulates the Rho/ROCK pathway, induces cardiac dysfunction and conduction disturbance JOURNAL Mol Cell Biol 28 (10), 3424-3436 (2008) PUBMED 18332105 REMARK GeneRIF: MURC modulates RhoA signaling, and MURC plays an important role in the development of cardiac dysfunction and conduction disturbance with increased vulnerability to atrial arrhythmias. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BC089601.1 and AL807771.6. On Mar 21, 2009 this sequence version replaced NM_026509.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC089601.1, AK009691.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849375, SAMN00849383 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1342 BC089601.1 1-1342 1343-1343 AL807771.6 44119-44119 1344-2062 BC089601.1 1344-2062 FEATURES Location/Qualifiers source 1..2062 /organism="Mus musculus" /mol_type="mRNA" /db_xref="taxon:10090" /chromosome="4" /map="4 26.23 cM" gene 1..2062 /gene="Cavin4" /gene_synonym="2310039E09Rik; Murc" /note="caveolae associated 4" /db_xref="GeneID:68016" /db_xref="MGI:MGI:1915266" exon 1..516 /gene="Cavin4" /gene_synonym="2310039E09Rik; Murc" /inference="alignment:Splign:2.1.0" misc_feature 94..96 /gene="Cavin4" /gene_synonym="2310039E09Rik; Murc" /note="upstream in-frame stop codon" CDS 109..1197 /gene="Cavin4" /gene_synonym="2310039E09Rik; Murc" /note="muscle-restricted coiled-coil protein; cavin 4; muscle-related coiled-coil protein" /codon_start=1 /product="caveolae-associated protein 4" /protein_id="NP_080785.2" /db_xref="CCDS:CCDS18169.2" /db_xref="GeneID:68016" /db_xref="MGI:MGI:1915266" /translation="
MEHNGSASNAGKIHQNRLSSVTEDEDQDAALTIVTVLDRVASVVDSVQASQKRIEERHREMGNAIKSVQIDLLKLSQSHSNTGYVVNKLFEKTRKVSAHIKDVKARVEKQQVRVTKVETKQEEIMKKNKFRVVIFQEDIPCPASLSVVKDRSLPENQEEAEEVFDPPIELSSDEEYYVEESRSARLRKSGKEHIDHIKKAFSRENMQKTRQTLDKKVSGIRTRIVTPERRERLRQSGERLRQSGERLRQSGERFKKSISSAAPSKEAFKIRSLRKAKDPKAEGQEVDRGMGVDIISGSLALGPIHEFHSDEFSETEKEVTKGGYSPQEGGDPPTPEPLKVTFKPQVRVEDDESLLLELKQSS"
misc_feature 109..180 /gene="Cavin4" /gene_synonym="2310039E09Rik; Murc" /note="propagated from UniProtKB/Swiss-Prot (A2AMM0.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 187..897 /gene="Cavin4" /gene_synonym="2310039E09Rik; Murc" /note="PTRF/SDPR family; Region: PTRF_SDPR; pfam15237" /db_xref="CDD:434559" misc_feature 562..564 /gene="Cavin4" /gene_synonym="2310039E09Rik; Murc" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:B1PRL5; propagated from UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site" misc_feature 619..621 /gene="Cavin4" /gene_synonym="2310039E09Rik; Murc" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:B1PRL5; propagated from UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site" misc_feature 622..624 /gene="Cavin4" /gene_synonym="2310039E09Rik; Murc" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:B1PRL5; propagated from UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site" misc_feature 796..975 /gene="Cavin4" /gene_synonym="2310039E09Rik; Murc" /note="propagated from UniProtKB/Swiss-Prot (A2AMM0.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 1021..1146 /gene="Cavin4" /gene_synonym="2310039E09Rik; Murc" /note="propagated from UniProtKB/Swiss-Prot (A2AMM0.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 1078..1080 /gene="Cavin4" /gene_synonym="2310039E09Rik; Murc" /note="Phosphotyrosine. /evidence=ECO:0007744|PubMed:21183079; propagated from UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site" misc_feature 1108..1110 /gene="Cavin4" /gene_synonym="2310039E09Rik; Murc" /note="Phosphothreonine. /evidence=ECO:0007744|PubMed:21183079; propagated from UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site" misc_feature 1165..1167 /gene="Cavin4" /gene_synonym="2310039E09Rik; Murc" /note="Phosphoserine. /evidence=ECO:0007744|PubMed:21183079; propagated from UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site" exon 517..2044 /gene="Cavin4" /gene_synonym="2310039E09Rik; Murc" /inference="alignment:Splign:2.1.0" ORIGIN
gttttcaaccctttaaagcagctccgttgcctgcttcctagccgacttttggctccaggcgtaggaaccggattgccataggacaccttctgctgagaaaaaagtaaaatggaacacaacggatcagcttcaaatgctggtaaaatccaccagaatcggttgtcaagtgtgacggaagatgaagaccaagacgcagccctcaccattgtgaccgtgctggacagagtggccagtgtcgtggacagtgtgcaggcaagccagaagagaattgaggagagacacagagaaatgggtaacgcgataaagtctgtccaaatagacctgctgaagctctcacagtcacacagcaatacgggctacgttgtcaacaagctgtttgagaagacccggaaagtcagcgctcacattaaggatgtcaaggcccgggtagagaagcaacaggttcgtgtaaccaaagtcgaaaccaagcaagaagaaataatgaagaaaaacaaattccgagtggtaatcttccaggaggacattccctgccccgcatccctgtctgttgttaaagacagaagcctgcccgagaaccaggaggaggccgaagaagtcttcgatcccccaatagagctctcctcggatgaggagtattatgttgaagaaagcagatctgccaggcttaggaagtcaggcaaagagcacattgaccacatcaagaaagccttttccagagaaaacatgcagaagacacggcagactcttgacaagaaagtgagtgggattagaactaggatagtcactcctgagaggagagagaggctgaggcagtcgggagagaggctgaggcagtcaggagagaggctgaggcagtcgggggaaagatttaagaaatcgatttccagtgccgctccctcaaaggaagcttttaagattcggagccttaggaaagcgaaggatcccaaggccgagggccaggaggtagacagagggatgggcgtggacatcatctcaggtagcctggctctggggcccatccatgagttccactctgatgagttcagtgaaacagaaaaggaggtgaccaaaggagggtacagtccccaagaaggaggggaccccccaacgcctgagcctttgaaggtgacttttaaaccccaggtgagggtagaggatgacgagtcactcctgttggagctaaagcagtcctcatagaggatttaagtacgagcatccatcacttggaatcatgtggttgtagtttgaatggtgtggtattcatattcatttatattcatccgcagtggaaaggcagatggtagaaaagcttcatttcttacctctaaaatcctaaagatgctggaaatattatatacaatttttgtacaatttccttgggaattctattcccctgagaatatatgactctgacagcaccccacccctgtctgcctacccccttacgtcatgccttttcgtggcagctcttggccaatgagaaaatagttgcacggctctggtcagttagatgatatgccattcataacacaggaacaacggatctgtgtccgttgttcatcagcaaactctagatctgggtcaggattgacacatccagtcaagaaggggagtagctgatgagtacatcgtgttatccagatgttcacatctggagattcattagtgagtcagtagccttatgaaggttacaaagttcttgtgtgagggaaaggaaatggaagtctgggacttgaacattttagctgcggcaacataactttattctagtgagatacttggctggttgccacatattctcaatgctaaaatgaaaaaaagggcttgctcttcctgtacttcttggagaacttgagatctgaggtggtgtcacagagtttgtgagaacaagacacacgacaagtggagaagcccacaaatcgcactggctcccctaacacagaatggaaacagttacatctgtgaggaagccctcggcacaggctccaaggccagagctgagcggaaactggggtggttcacaagtcttcacggaataaagagtaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]