LOCUS       NM_018885               2576 bp    mRNA    linear   ROD 15-JUN-2024
DEFINITION  Mus musculus Iroquois homeobox 4 (Irx4), transcript variant 1,
            mRNA.
ACCESSION   NM_018885
VERSION     NM_018885.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 2576)
  AUTHORS   Narwidina,A., Miyazaki,A., Iwata,K., Kurogoushi,R., Sugimoto,A.,
            Kudo,Y., Kawarabayashi,K., Yamakawa,Y., Akazawa,Y., Kitamura,T.,
            Nakagawa,H., Yamaguchi-Ueda,K., Hasegawa,T., Yoshizaki,K.,
            Fukumoto,S., Yamamoto,A., Ishimaru,N., Iwasaki,T. and Iwamoto,T.
  TITLE     Iroquois homeobox 3 regulates odontoblast proliferation and
            differentiation mediated by Wnt5a expression
  JOURNAL   Biochem Biophys Res Commun 650, 47-54 (2023)
   PUBMED   36773339
REFERENCE   2  (bases 1 to 2576)
  AUTHORS   Cattaneo,P., Hayes,M.G.B., Baumgarten,N., Hecker,D., Peruzzo,S.,
            Aslan,G.S., Kunderfranco,P., Larcher,V., Zhang,L., Contu,R.,
            Fonseca,G., Spinozzi,S., Chen,J., Condorelli,G., Dimmeler,S.,
            Schulz,M.H., Heinz,S., Guimaraes-Camboa,N. and Evans,S.M.
  TITLE     DOT1L regulates chamber-specific transcriptional networks during
            cardiogenesis and mediates postnatal cell cycle withdrawal
  JOURNAL   Nat Commun 13 (1), 7444 (2022)
   PUBMED   36460641
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2576)
  AUTHORS   de Soysa,T.Y., Ranade,S.S., Okawa,S., Ravichandran,S., Huang,Y.,
            Salunga,H.T., Schricker,A., Del Sol,A., Gifford,C.A. and
            Srivastava,D.
  TITLE     Single-cell analysis of cardiogenesis reveals basis for organ-level
            developmental defects
  JOURNAL   Nature 572 (7767), 120-124 (2019)
   PUBMED   31341279
REFERENCE   4  (bases 1 to 2576)
  AUTHORS   Wang,Y., Lu,P., Wu,B., Morrow,B.E. and Zhou,B.
  TITLE     NOTCH maintains developmental cardiac gene network through WNT5A
  JOURNAL   J Mol Cell Cardiol 125, 98-105 (2018)
   PUBMED   30347193
REFERENCE   5  (bases 1 to 2576)
  AUTHORS   Kiyama,T., Chen,C.K., Wang,S.W., Pan,P., Ju,Z., Wang,J., Takada,S.,
            Klein,W.H. and Mao,C.A.
  TITLE     Essential roles of mitochondrial biogenesis regulator Nrf1 in
            retinal development and homeostasis
  JOURNAL   Mol Neurodegener 13 (1), 56 (2018)
   PUBMED   30333037
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 2576)
  AUTHORS   Bruneau,B.G., Bao,Z.Z., Fatkin,D., Xavier-Neto,J.,
            Georgakopoulos,D., Maguire,C.T., Berul,C.I., Kass,D.A., Kuroski-de
            Bold,M.L., de Bold,A.J., Conner,D.A., Rosenthal,N., Cepko,C.L.,
            Seidman,C.E. and Seidman,J.G.
  TITLE     Cardiomyopathy in Irx4-deficient mice is preceded by abnormal
            ventricular gene expression
  JOURNAL   Mol Cell Biol 21 (5), 1730-1736 (2001)
   PUBMED   11238910
REFERENCE   7  (bases 1 to 2576)
  AUTHORS   Peters,T., Dildrop,R., Ausmeier,K. and Ruther,U.
  TITLE     Organization of mouse Iroquois homeobox genes in two clusters
            suggests a conserved regulation and function in vertebrate
            development
  JOURNAL   Genome Res 10 (10), 1453-1462 (2000)
   PUBMED   11042145
REFERENCE   8  (bases 1 to 2576)
  AUTHORS   Christoffels,V.M., Keijser,A.G., Houweling,A.C., Clout,D.E. and
            Moorman,A.F.
  TITLE     Patterning the embryonic heart: identification of five mouse
            Iroquois homeobox genes in the developing heart
  JOURNAL   Dev Biol 224 (2), 263-274 (2000)
   PUBMED   10926765
REFERENCE   9  (bases 1 to 2576)
  AUTHORS   Christoffels,V.M., Habets,P.E., Franco,D., Campione,M., de Jong,F.,
            Lamers,W.H., Bao,Z.Z., Palmer,S., Biben,C., Harvey,R.P. and
            Moorman,A.F.
  TITLE     Chamber formation and morphogenesis in the developing mammalian
            heart
  JOURNAL   Dev Biol 223 (2), 266-278 (2000)
   PUBMED   10882515
  REMARK    Erratum:[Dev Biol 2000 Sep 1;225(1):266]
REFERENCE   10 (bases 1 to 2576)
  AUTHORS   Bruneau,B.G., Bao,Z.Z., Tanaka,M., Schott,J.J., Izumo,S.,
            Cepko,C.L., Seidman,J.G. and Seidman,C.E.
  TITLE     Cardiac expression of the ventricle-specific homeobox gene Irx4 is
            modulated by Nkx2-5 and dHand
  JOURNAL   Dev Biol 217 (2), 266-277 (2000)
   PUBMED   10625552
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC154266.2.
            
            On Dec 19, 2023 this sequence version replaced NM_018885.2.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK132571.1, AF124732.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849375, SAMN00849390
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-353               AC154266.2         56424-56776
            354-485             AC154266.2         60748-60879
            486-737             AC154266.2         61358-61609
            738-850             AC154266.2         62496-62608
            851-1179            AC154266.2         63404-63732
            1180-2576           AC154266.2         64126-65522
FEATURES             Location/Qualifiers
     source          1..2576
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="13"
                     /map="13 39.64 cM"
     gene            1..2576
                     /gene="Irx4"
                     /note="Iroquois homeobox 4"
                     /db_xref="GeneID:50916"
                     /db_xref="MGI:MGI:1355275"
     exon            1..353
                     /gene="Irx4"
                     /inference="alignment:Splign:2.1.0"
     exon            354..485
                     /gene="Irx4"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    426..428
                     /gene="Irx4"
                     /note="upstream in-frame stop codon"
     CDS             441..1988
                     /gene="Irx4"
                     /note="homeodomain protein IRXA3; iroquois homeobox
                     protein 4; Iroquois related homeobox 4"
                     /codon_start=1
                     /product="iroquois-class homeodomain protein IRX-4"
                     /protein_id="NP_061373.1"
                     /db_xref="CCDS:CCDS26629.1"
                     /db_xref="GeneID:50916"
                     /db_xref="MGI:MGI:1355275"
                     /translation="

MSYPQFGYPYSSAPQFLMTTNSLSTCCESGGRTLADSGPAASAQAPVYCPVYESRLLATARHELNSAAALGVYGSPYGSSQGYGNYVTYGSEASAFYSLNSFESKDGTGSSHAGLPPTAAAAYYPYEPALSQYPYDRYGTVDSGTRRKNATRETTSTLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWPPRNKCADEKRPYGEGEEEEAGEEESREEPLKSAKSEGHAGKDDKELELSDLEDFDPLDAETSECELKTPFQSLDSGPERIPASSDGPGTGKEASTTLRMPLGTAGGAVMDGDLERARNCLRSTVVVPDSGAEGGPPACEAKLTFAQAGAPPNLETKPRIWSLAHTATAAAATALSQTEFPSCMLKRQGPTGVSATTPASSPAVTAPSGALDRHQDSPVTSLRNWVDGVFHDPILRHSTLNQAWATAKGALLDPGPLGRNLGAGTNVLTTPLACSFPPTVPQDVPPAGASRELLATPKAGGKPFCT"

     misc_feature    order(876..884,888..890,948..950,966..968,1005..1007,
                     1011..1016,1023..1028,1032..1040,1044..1049)
                     /gene="Irx4"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(876..878,885..887,1014..1016,1023..1028,1035..1037)
                     /gene="Irx4"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    924..1040
                     /gene="Irx4"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
     misc_feature    1053..1214
                     /gene="Irx4"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9QY61.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    1272..1361
                     /gene="Irx4"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9QY61.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    1632..1715
                     /gene="Irx4"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9QY61.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            486..737
                     /gene="Irx4"
                     /inference="alignment:Splign:2.1.0"
     exon            738..850
                     /gene="Irx4"
                     /inference="alignment:Splign:2.1.0"
     exon            851..1179
                     /gene="Irx4"
                     /inference="alignment:Splign:2.1.0"
     exon            1180..2576
                     /gene="Irx4"
                     /inference="alignment:Splign:2.1.0"
     regulatory      2531..2536
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Irx4"
                     /note="hexamer: AATATA"
     regulatory      2545..2550
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Irx4"
                     /note="hexamer: AATAAA"
     polyA_site      2550
                     /gene="Irx4"
     polyA_site      2576
                     /gene="Irx4"
                     /note="major polyA site"
ORIGIN      

gctctgctctccaggtgctccgcctggaaatgtctccattagttgtcgcttgctccccgccggagcgcgcgcgcccagcggccgcgcagagccctagcgggcagccaggagtggcccggcgccactgcaggtaggcaaggtccccacgcccgccccctcccggggttccgagacccctccccccctttcgaggaggcggaggaggcagaggctccgcgcggccgccgaggggcgcgggcggcggaggcggcggcggcagcggcggcggtgactccccggtgcgtcccgggctgcgcgctgctcccggaggccctggcgcctaagcggcgcgggccggctctttcctggcgcagagcctaggatcctacaactccggagcagtgcccacgctgtgcacaggaccccaacggcccctcagaccttcttaggccgcacccgccatgtcctacccgcagtttggatacccctattcctctgctcctcagttcctgatgaccaccaactccctgagcacgtgctgcgagtcgggcggccgcacactggctgattccgggcctgcagcctcggcacaggcgcccgtctactgccctgtctacgagagccggctgctggccactgcacgccacgaactcaattctgccgccgcgctcggcgtctacgggagcccctatggcagctcgcagggctatggcaactacgtgacctatggctctgaggcatctgctttctactctctgaacagcttcgagtccaaggatggcacaggatcttcacacgccggcctaccacccactgcagctgcagcctactacccgtatgagccagctctgagccagtacccatatgacaggtacgggaccgtggacagcggcacgcggcgcaagaatgccacccgggagaccaccagcacactgaaggcctggctgcaggagcaccggaagaacccgtaccccaccaaaggagagaagatcatgctggccatcatcaccaagatgaccctcacacaggtttccacctggtttgccaacgcacgtcggcgcctcaagaaggagaacaagatgacctggccacctagaaataaatgtgcagatgagaagcgcccctatggggagggggaggaggaggaggctggagaggaggagtcacgggaggagcctctcaagagtgccaagagcgaaggtcatgctggcaaagacgacaaggagctagaactcagtgacttggaagacttcgaccctctagatgcagagacctcagaatgtgagctgaagacgcccttccagtccctggatagtggaccagagaggattcctgcttcatctgatggtcccggcacaggcaaggaggcctccaccacactccggatgcccctgggcaccgctggtggagctgttatggatggggatctggagagggcaaggaactgcctccggagcacagtggtcgttcctgactctggcgccgagggcggcccacctgcttgcgaagccaaactgacctttgctcaggcgggagcgccgccgaacctggagaccaagccccgcatctggtccttggcacacacagccaccgctgctgcagccacagctctgagccagactgagtttccctcctgcatgctgaaacgccaaggtccaacgggtgtatctgcgacgacgccagcgtcctcacctgcagtcacggccccttctggggctctggataggcaccaggactccccagtaactagcctcagaaactgggtggatggggtatttcacgatcccatccttagacacagcactttgaaccaggcctgggccaccgctaagggcgcacttctggatcccggccctctaggacgcaatctgggggcgggtactaacgtactgacgacgccccttgcttgctccttcccgcccacggtgccccaagacgtcccacctgcaggggcctcccgggagctgctggctacgcccaaggccggtggcaaacccttctgcacttaacacccacctgcacagtggagaagggaactggcgctcaggctgcaggcgctgactctgaactgctttaaatgggtttccaaaagaagggggaatttccaagccaagattgccaacccacttgagacagaggatttgaactcaacctccagggctatggaggaactcctcgcgttctatcaccaggttttacctgatgttgcgtccacctgagccatcccttaactccaggaagatgagaagaccggagagcacagccgatgggaggccccctgaagcataaagtttacgtccaaagtttacatggagaaggcatttgggtactgaggcttgttttgtgtcgctgtctccttctgggtttgaggcatgccggtgttcgtgcgaagagtcttcagcccgtttttcttcggacttcatcctcagcacgtagagctcaccgccaacacttccaccgagtttacactgttgcacactcttgactcgacaaaattatgttttctaaaatgtatattcacaccagtaattgcctgtttcagagggaggctaatataacaaaactaataaattttcgtgtttgcattgcggaaggaa

//