LOCUS       NM_011320               1323 bp    mRNA    linear   ROD 06-APR-2024
DEFINITION  Mus musculus NK1 homeobox 1 (Nkx1-1), mRNA.
ACCESSION   NM_011320 XM_001473635 XM_006543936
VERSION     NM_011320.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1323)
  AUTHORS   Thompson,C.L., Ng,L., Menon,V., Martinez,S., Lee,C.K.,
            Glattfelder,K., Sunkin,S.M., Henry,A., Lau,C., Dang,C.,
            Garcia-Lopez,R., Martinez-Ferre,A., Pombero,A., Rubenstein,J.L.R.,
            Wakeman,W.B., Hohmann,J., Dee,N., Sodt,A.J., Young,R., Smith,K.,
            Nguyen,T.N., Kidney,J., Kuan,L., Jeromin,A., Kaykas,A., Miller,J.,
            Page,D., Orta,G., Bernard,A., Riley,Z., Smith,S., Wohnoutka,P.,
            Hawrylycz,M.J., Puelles,L. and Jones,A.R.
  TITLE     A high-resolution spatiotemporal atlas of gene expression of the
            developing mouse brain
  JOURNAL   Neuron 83 (2), 309-323 (2014)
   PUBMED   24952961
REFERENCE   2  (bases 1 to 1323)
  AUTHORS   Simon,R., Britsch,S. and Bergemann,A.
  TITLE     Ablation of Sax2 gene expression prevents diet-induced obesity
  JOURNAL   FEBS J 278 (2), 371-382 (2011)
   PUBMED   21126319
  REMARK    GeneRIF: Sax2 gene expression plays a critical role in diet-induced
            obesity.
REFERENCE   3  (bases 1 to 1323)
  AUTHORS   Simon,R., Lufkin,T. and Bergemann,A.D.
  TITLE     Homeobox gene Sax2 deficiency causes an imbalance in energy
            homeostasis
  JOURNAL   Dev Dyn 236 (10), 2792-2799 (2007)
   PUBMED   17879320
  REMARK    GeneRIF: These data strongly suggest that Sax2 is required for the
            coordinated crosstalk of factors involved in the maintenance of
            energy homeostasis.
REFERENCE   4  (bases 1 to 1323)
  AUTHORS   Simon,R. and Lufkin,T.
  TITLE     Postnatal lethality in mice lacking the Sax2 homeobox gene
            homologous to Drosophila S59/slouch: evidence for positive and
            negative autoregulation
  JOURNAL   Mol Cell Biol 23 (24), 9046-9060 (2003)
   PUBMED   14645517
  REMARK    GeneRIF: Sax2 gene expression occurs early during embryogenesis in
            the midbrain, the midbrain-hindbrain boundary, the ventral neural
            tube, the developing eye, and the apical ectodermal ridge of the
            limb.
REFERENCE   5  (bases 1 to 1323)
  AUTHORS   Chen,X. and Lufkin,T.
  TITLE     Linkage mapping of Sax2 to mouse chromosome 5
  JOURNAL   Mamm Genome 8 (9), 697-698 (1997)
   PUBMED   9271676
REFERENCE   6  (bases 1 to 1323)
  AUTHORS   Yamada,G., Kioussi,C., Schubert,F.R., Eto,Y., Chowdhury,K.,
            Pituello,F. and Gruss,P.
  TITLE     Regulated expression of Brachyury(T), Nkx1.1 and Pax genes in
            embryoid bodies
  JOURNAL   Biochem Biophys Res Commun 199 (2), 552-563 (1994)
   PUBMED   7907867
REFERENCE   7  (bases 1 to 1323)
  AUTHORS   Bober,E., Baum,C., Braun,T. and Arnold,H.H.
  TITLE     A novel NK-related mouse homeobox gene: expression in central and
            peripheral nervous structures during embryonic development
  JOURNAL   Dev Biol 162 (1), 288-303 (1994)
   PUBMED   7510254
REFERENCE   8  (bases 1 to 1323)
  AUTHORS   Kim,Y. and Nirenberg,M.
  TITLE     Drosophila NK-homeobox genes
  JOURNAL   Proc Natl Acad Sci U S A 86 (20), 7716-7720 (1989)
   PUBMED   2573058
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AC145072.9.
            
            On or before Feb 22, 2014 this sequence version replaced
            XM_001473635.2, XM_006543936.1.
            
            Sequence Note: The RefSeq transcript was derived from the reference
            genome assembly. The genomic coordinates were determined from
            alignments.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMN00849374,
                              SAMN00849383 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            inferred exon combination :: based on alignments, homology
            RefSeq Select criteria    :: based on single protein-coding
                                         transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-466               AC145072.9         110004-110469
            467-1323            AC145072.9         112504-113360
FEATURES             Location/Qualifiers
     source          1..1323
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="5"
                     /map="5 17.65 cM"
     gene            1..1323
                     /gene="Nkx1-1"
                     /gene_synonym="Nkx-1.1; Sax2"
                     /note="NK1 homeobox 1"
                     /db_xref="GeneID:672284"
                     /db_xref="MGI:MGI:109346"
     CDS             1..1323
                     /gene="Nkx1-1"
                     /gene_synonym="Nkx-1.1; Sax2"
                     /note="spinal cord axial homeobox gene 2; NK1
                     transcription factor related, locus 1; homeobox protein
                     SAX-2"
                     /codon_start=1
                     /product="NK1 transcription factor-related protein 1"
                     /protein_id="NP_035450.1"
                     /db_xref="GeneID:672284"
                     /db_xref="MGI:MGI:109346"
                     /translation="

MSTSGPAAPGDVPALPPPPPGPGSGPAPPAPAATARDTMDGRAELPIFPRAGVPPLAASDTVPAVPEGAGAARPAAPPRPTSFSVLDILDPNKFNSRRRRCVLLGPVVPATCAPCAPAACVAVPAASGRSPRAELERRALSAATGVAAAAGAEPTSAGDSYRADEAEANGYSSGSGRSPTADSEDEAPEDEDEEEAPEVQDAQGTEEPRGGSGGLGARGSGCPGAAEVEASPVDDTAAPGPRGNSPGAPGPPATATGAGSAGSTPQGAAVTTKPKRKRTGSDSKSGKPRRARTAFTYEQLVALENKFKATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADTSAPTGGGGGPGPGAGPGAGLPGGLSPLSPSPPMGAPLALHGPAGYPAHSPGGLVCAAQLPFLSSPAVLSPFVLGSQTYGAPAFYAPHL"

     misc_feature    1..246
                     /gene="Nkx1-1"
                     /gene_synonym="Nkx-1.1; Sax2"
                     /note="propagated from UniProtKB/Swiss-Prot (G3UXB3.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    433..873
                     /gene="Nkx1-1"
                     /gene_synonym="Nkx-1.1; Sax2"
                     /note="propagated from UniProtKB/Swiss-Prot (G3UXB3.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    865..1035
                     /gene="Nkx1-1"
                     /gene_synonym="Nkx-1.1; Sax2"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    1024..1161
                     /gene="Nkx1-1"
                     /gene_synonym="Nkx-1.1; Sax2"
                     /note="propagated from UniProtKB/Swiss-Prot (G3UXB3.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            1..466
                     /gene="Nkx1-1"
                     /gene_synonym="Nkx-1.1; Sax2"
                     /inference="alignment:Splign:2.1.0"
     exon            467..1323
                     /gene="Nkx1-1"
                     /gene_synonym="Nkx-1.1; Sax2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atgagtaccagcggcccggcggcacccggggacgtccccgcgctgccaccgccaccgcccgggcccggctcggggcccgcaccgccggctcctgcggctacagctcgggacactatggacggacgagctgagctgcccatctttccccgggctggagtgccaccgctcgcggccagcgacactgttcccgcggtgccagagggggctggagcggcccggcccgccgcgcccccgcgccccacctccttctccgtgttggacatcctagatcccaacaagttcaacagtaggagacgccgctgcgtgctactgggccctgtggtgcccgctacgtgtgccccatgcgccccggccgcgtgcgtcgcggtccccgctgcctccggacgttcgccgcgcgcagagctagaacgccgagccctctccgccgccacaggagtcgcagcggccgcgggagctgagcctacaagtgctggggactcttacagggcggacgaggccgaggccaacggctacagcagcggcagcggtcgcagcccgaccgcggacagcgaggatgaagcgccggaggacgaggacgaggaagaagcgcccgaggtgcaggatgctcagggcacggaggagcctcggggaggcagcggcggtctcggggcccgcgggtcgggctgccccggagcggccgaggtcgaggcttcccctgtggacgatactgcggccccagggccccgtgggaactcgcccggagccccgggcccgcctgcaactgctacgggagcggggagcgcggggagtaccccgcagggcgccgccgtgaccaccaagcccaagcggaagcgcacgggctcggactcgaagtccgggaagccgaggcgtgcgcgcaccgccttcacctacgagcagctcgtggcgctggagaacaagtttaaggccactcgctacctgtcggtgtgcgagcgcctcaacctggcgctgtcgctgagcctcaccgagacgcaggtgaagatctggttccagaaccgccgaaccaagtggaagaagcaaaacccaggcgctgacaccagcgcgccgaccggcggcggcgggggccccggcccgggagcggggcccggcgcggggctgcccggcggcctcagtccgctcagcccctcgcctcccatgggcgctccgctcgccttgcacggcccggccgggtacccggcgcacagcccaggagggctggtgtgtgctgcgcagctgcccttcctgtccagcccggccgtgctgtcgcccttcgtgctgggctcgcagacgtacggcgcgcccgccttctatgcgccccacctctga

//