GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-06 18:01:46, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_011292                737 bp    mRNA    linear   ROD 04-AUG-2023
DEFINITION  Mus musculus ribosomal protein L9 (Rpl9), mRNA.
ACCESSION   NM_011292
VERSION     NM_011292.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 737)
  AUTHORS   Li H, Huo Y, He X, Yao L, Zhang H, Cui Y, Xiao H, Xie W, Zhang D,
            Wang Y, Zhang S, Tu H, Cheng Y, Guo Y, Cao X, Zhu Y, Jiang T, Guo
            X, Qin Y and Sha J.
  TITLE     A male germ-cell-specific ribosome controls male fertility
  JOURNAL   Nature 612 (7941), 725-731 (2022)
   PUBMED   36517592
REFERENCE   2  (bases 1 to 737)
  AUTHORS   Watanabe M, Toyomura T, Wake H, Nishinaka T, Hatipoglu OF,
            Takahashi H, Nishibori M and Mori S.
  TITLE     Identification of ribosomal protein L9 as a novel regulator of
            proinflammatory damage-associated molecular pattern molecules
  JOURNAL   Mol Biol Rep 49 (4), 2831-2838 (2022)
   PUBMED   35059969
  REMARK    GeneRIF: Identification of ribosomal protein L9 as a novel
            regulator of proinflammatory damage-associated molecular pattern
            molecules.
REFERENCE   3  (bases 1 to 737)
  AUTHORS   Khatter H, Myasnikov AG, Natchiar SK and Klaholz BP.
  TITLE     Structure of the human 80S ribosome
  JOURNAL   Nature 520 (7549), 640-645 (2015)
   PUBMED   25901680
REFERENCE   4  (bases 1 to 737)
  AUTHORS   Beyer AR, Bann DV, Rice B, Pultz IS, Kane M, Goff SP, Golovkina TV
            and Parent LJ.
  TITLE     Nucleolar trafficking of the mouse mammary tumor virus gag protein
            induced by interaction with ribosomal protein L9
  JOURNAL   J Virol 87 (2), 1069-1082 (2013)
   PUBMED   23135726
  REMARK    GeneRIF: These data support the hypothesis that efficient mouse
            mammary tumor virus particle assembly is dependent upon the
            interaction of Gag and L9 in the nucleoli of infected cells.
REFERENCE   5  (bases 1 to 737)
  AUTHORS   Kondrashov N, Pusic A, Stumpf CR, Shimizu K, Hsieh AC, Ishijima J,
            Shiroishi T and Barna M.
  TITLE     Ribosome-mediated specificity in Hox mRNA translation and
            vertebrate tissue patterning
  JOURNAL   Cell 145 (3), 383-397 (2011)
   PUBMED   21529712
REFERENCE   6  (bases 1 to 737)
  AUTHORS   Trinidad JC, Specht CG, Thalhammer A, Schoepfer R and Burlingame
            AL.
  TITLE     Comprehensive identification of phosphorylation sites in
            postsynaptic density preparations
  JOURNAL   Mol Cell Proteomics 5 (5), 914-922 (2006)
   PUBMED   16452087
REFERENCE   7  (bases 1 to 737)
  AUTHORS   Ko MS, Threat TA, Wang X, Horton JH, Cui Y, Wang X, Pryor E, Paris
            J, Wells-Smith J, Kitchen JR, Rowe LB, Eppig J, Satoh T, Brant L,
            Fujiwara H, Yotsumoto S and Nakashima H.
  TITLE     Genome-wide mapping of unselected transcripts from extraembryonic
            tissue of 7.5-day mouse embryos reveals enrichment in the t-complex
            and under-representation on the X chromosome
  JOURNAL   Hum Mol Genet 7 (12), 1967-1978 (1998)
   PUBMED   9811942
REFERENCE   8  (bases 1 to 737)
  AUTHORS   Monach PA, Meredith SC, Siegel CT and Schreiber H.
  TITLE     A unique tumor antigen produced by a single amino acid substitution
  JOURNAL   Immunity 2 (1), 45-59 (1995)
   PUBMED   7600302
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BY072215.1 and BC089319.1.
            
            On Jul 24, 2008 this sequence version replaced NM_011292.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC086937.1, CF949991.1 [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMN00849374,
                                           SAMN00849375 [ECO:0006172]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-51                BY072215.1         2-52
            52-737              BC089319.1         1-686
FEATURES             Location/Qualifiers
     source          1..737
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="5"
                     /map="5 33.66 cM"
     gene            1..737
                     /gene="Rpl9"
                     /note="ribosomal protein L9"
                     /db_xref="GeneID:20005"
                     /db_xref="MGI:MGI:1298373"
     exon            1..56
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     exon            57..103
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     CDS             58..636
                     /gene="Rpl9"
                     /note="60S ribosomal protein L9"
                     /codon_start=1
                     /product="large ribosomal subunit protein uL6"
                     /protein_id="NP_035422.1"
                     /db_xref="CCDS:CCDS39097.1"
                     /db_xref="GeneID:20005"
                     /db_xref="MGI:MGI:1298373"
                     /translation="
MKTILSNQTVDIPENVEITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRTGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE"
     misc_feature    58..630
                     /gene="Rpl9"
                     /note="60S ribosomal protein L6; Provisional; Region:
                     PTZ00027"
                     /db_xref="CDD:240234"
     misc_feature    418..420
                     /gene="Rpl9"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P32969; propagated from
                     UniProtKB/Swiss-Prot (P51410.2); acetylation site"
     exon            104..219
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     exon            220..315
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     exon            316..448
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     exon            449..529
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     exon            530..647
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     exon            648..725
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ggattacaagaacgtgatgacgaaagacgttctctctttgccccatctactgcgaggatgaagaccattctcagcaatcagactgtggacattccagagaatgtcgaaatcactctgaaggggcgcacagtcattgtgaagggccccagggggactctgcggagggacttcaatcacatcaacgtggagctgagtcttcttgggaagaagaagaaaaggctccgggttgacaaatggtggggtaacagaaaggaactggccaccgtcaggaccatctgcagtcatgttcagaacatgatcaagggtgtcacgctgggcttccgatacaagatgcggtctgtgtacgctcacttccccatcaacgtcgtcatccaggagaatggctctttggttgaaatccgaaatttcttgggtgaaaaatacatccgcagggttcggatgaggacaggtgtggcttgttctgtctctcaagcccagaaggatgagttaatccttgaaggaaatgacattgaacttgtttcaaattcagctgccctgattcagcaagccacaacagttaaaaacaaggatatcaggaagtttttggacggcatctatgtgtctgagaagggaactgtgcagcaggctgacgagtgaggaggcctcagttcctggccccagaaacgagatcctgaccacatgaacaatttgggctcttttgggagaataaaagacttatatattgaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]