LOCUS       NM_010692                819 bp    mRNA    linear   ROD 05-JUN-2024
DEFINITION  Mus musculus ladybird homeobox 2 (Lbx2), mRNA.
ACCESSION   NM_010692
VERSION     NM_010692.4
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 819)
  AUTHORS   Thompson,C.L., Ng,L., Menon,V., Martinez,S., Lee,C.K.,
            Glattfelder,K., Sunkin,S.M., Henry,A., Lau,C., Dang,C.,
            Garcia-Lopez,R., Martinez-Ferre,A., Pombero,A., Rubenstein,J.L.R.,
            Wakeman,W.B., Hohmann,J., Dee,N., Sodt,A.J., Young,R., Smith,K.,
            Nguyen,T.N., Kidney,J., Kuan,L., Jeromin,A., Kaykas,A., Miller,J.,
            Page,D., Orta,G., Bernard,A., Riley,Z., Smith,S., Wohnoutka,P.,
            Hawrylycz,M.J., Puelles,L. and Jones,A.R.
  TITLE     A high-resolution spatiotemporal atlas of gene expression of the
            developing mouse brain
  JOURNAL   Neuron 83 (2), 309-323 (2014)
   PUBMED   24952961
REFERENCE   2  (bases 1 to 819)
  AUTHORS   Wiese,C.B., Ireland,S., Fleming,N.L., Yu,J., Valerius,M.T.,
            Georgas,K., Chiu,H.S., Brennan,J., Armstrong,J., Little,M.H.,
            McMahon,A.P. and Southard-Smith,E.M.
  TITLE     A genome-wide screen to identify transcription factors expressed in
            pelvic Ganglia of the lower urinary tract
  JOURNAL   Front Neurosci 6, 130 (2012)
   PUBMED   22988430
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 819)
  AUTHORS   Gerber,S.D., Amann,R., Wyder,S. and Trueb,B.
  TITLE     Comparison of the gene expression profiles from normal and Fgfrl1
            deficient mouse kidneys reveals downstream targets of Fgfrl1
            signaling
  JOURNAL   PLoS One 7 (3), e33457 (2012)
   PUBMED   22432025
REFERENCE   4  (bases 1 to 819)
  AUTHORS   Chung,Y.C., Tsai,Y.J., Shiu,T.Y., Sun,Y.Y., Wang,P.F. and Chen,C.L.
  TITLE     Screening large numbers of expression patterns of transcription
            factors in late stages of the mouse thymus
  JOURNAL   Gene Expr Patterns 11 (1-2), 84-92 (2011)
   PUBMED   20932939
REFERENCE   5  (bases 1 to 819)
  AUTHORS   Moisan,V., Robert,N.M. and Tremblay,J.J.
  TITLE     Expression of ladybird-like homeobox 2 (LBX2) during ovarian
            development and folliculogenesis in the mouse
  JOURNAL   J Mol Histol 41 (4-5), 289-294 (2010)
   PUBMED   20820887
  REMARK    GeneRIF: LBX2 has a role in ovarian maturation and
            folliculogenesis.
REFERENCE   6  (bases 1 to 819)
  AUTHORS   Wei,K., Chen,J., Akrami,K., Sekhon,R. and Chen,F.
  TITLE     Generation of mice deficient for Lbx2, a gene expressed in the
            urogenital system, nervous system, and Pax3 dependent tissues
  JOURNAL   Genesis 45 (6), 361-368 (2007)
   PUBMED   17492753
  REMARK    GeneRIF: Pax3 is required for Lbx2 expression in affected neural
            crest-derived tissues
REFERENCE   7  (bases 1 to 819)
  AUTHORS   Li,X., Oghi,K.A., Zhang,J., Krones,A., Bush,K.T., Glass,C.K.,
            Nigam,S.K., Aggarwal,A.K., Maas,R., Rose,D.W. and Rosenfeld,M.G.
  TITLE     Eya protein phosphatase activity regulates Six1-Dach-Eya
            transcriptional effects in mammalian organogenesis
  JOURNAL   Nature 426 (6964), 247-254 (2003)
   PUBMED   14628042
  REMARK    Erratum:[Nature. 2004 Jan 15;427(6971):265]
REFERENCE   8  (bases 1 to 819)
  AUTHORS   Chen,F., Collin,G.B., Liu,K.C., Beier,D.R., Eccles,M.,
            Nishina,P.M., Moshang,T. and Epstein,J.A.
  TITLE     Characterization of the murine Lbx2 promoter, identification of the
            human homologue, and evaluation as a candidate for Alstrom syndrome
  JOURNAL   Genomics 74 (2), 219-227 (2001)
   PUBMED   11386758
REFERENCE   9  (bases 1 to 819)
  AUTHORS   Kozmik,Z., Holland,L.Z., Schubert,M., Lacalli,T.C., Kreslova,J.,
            Vlcek,C. and Holland,N.D.
  TITLE     Characterization of Amphioxus AmphiVent, an evolutionarily
            conserved marker for chordate ventral mesoderm
  JOURNAL   Genesis 29 (4), 172-179 (2001)
   PUBMED   11309850
REFERENCE   10 (bases 1 to 819)
  AUTHORS   Chen,F., Liu,K.C. and Epstein,J.A.
  TITLE     Lbx2, a novel murine homeobox gene related to the Drosophila
            ladybird genes is expressed in the developing urogenital system,
            eye and brain
  JOURNAL   Mech Dev 84 (1-2), 181-184 (1999)
   PUBMED   10473138
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC104324.21, AK002897.1 and AI324150.1.
            
            On Feb 26, 2018 this sequence version replaced NM_010692.3.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK002897.1, BC109347.2 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849379
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-28                AC104324.21        122906-122933
            29-810              AK002897.1         29-810
            811-819             AI324150.1         3-11                c
FEATURES             Location/Qualifiers
     source          1..819
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="6"
                     /map="6 35.94 cM"
     gene            1..819
                     /gene="Lbx2"
                     /gene_synonym="Lbx2h"
                     /note="ladybird homeobox 2"
                     /db_xref="GeneID:16815"
                     /db_xref="MGI:MGI:1342288"
     exon            1..258
                     /gene="Lbx2"
                     /gene_synonym="Lbx2h"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    3..5
                     /gene="Lbx2"
                     /gene_synonym="Lbx2h"
                     /note="upstream in-frame stop codon"
     CDS             60..647
                     /gene="Lbx2"
                     /gene_synonym="Lbx2h"
                     /note="ladybird homeobox protein homolog 2; lady bird-like
                     homeobox 2 homolog; ladybird homeobox homolog 2"
                     /codon_start=1
                     /product="transcription factor LBX2"
                     /protein_id="NP_034822.1"
                     /db_xref="CCDS:CCDS20271.1"
                     /db_xref="GeneID:16815"
                     /db_xref="MGI:MGI:1342288"
                     /translation="

MNSVHQRRTPFSIADILGPSMVPEAPSAPQLPEAGPDPASPLCALEELASKTFLGHSPRATPQPSEGRAAPEAPPGPGAGVRRRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLAARLGLANAQVVTWFQNRRAKLKRDVEEMRADVASLCGLSPGVLCYPALPDSTSSPDPGPSGPDSEPNLSDEEIQVDD"

     misc_feature    60..326
                     /gene="Lbx2"
                     /gene_synonym="Lbx2h"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9WUN8.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    312..482
                     /gene="Lbx2"
                     /gene_synonym="Lbx2h"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    549..644
                     /gene="Lbx2"
                     /gene_synonym="Lbx2h"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9WUN8.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            259..819
                     /gene="Lbx2"
                     /gene_synonym="Lbx2h"
                     /inference="alignment:Splign:2.1.0"
     regulatory      793..798
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Lbx2"
                     /gene_synonym="Lbx2h"
                     /note="hexamer: AATAAA"
     polyA_site      819
                     /gene="Lbx2"
                     /gene_synonym="Lbx2h"
                     /note="major polyA site"
ORIGIN      

cctaggaggttgtgaagccaagcgcagcagaaggcgggatcgctacaatcccgcttgccatgaactctgtacatcagcgccggacaccctttagtatcgcagacatcctaggtccgagcatggtccccgaagcaccttctgcaccgcagcttcccgaggccggccctgatcccgcgtcaccactgtgtgcgctggaggagctagcaagtaaaactttcctgggccattccccgcgggctacaccacagccttctgaaggcagagccgccccggaggcgccgccggggcctggcgctggtgtccggagacgccgcaagtctcggacagcgttcactgcacagcaggtgctggagctggagcggcgattcgtcttccagaagtacttggcaccgtcagagcgcgacggacttgctgcgcgactgggcctggctaatgcgcaagtggtcacttggttccagaaccgtcgcgccaagctcaagcgggatgtggaggagatgcgcgcggacgtggcctccctatgcgggttgtcccctggagtcctgtgttacccagcactgccagacagcacttcaagccctgaccctggcccttcagggcccgattctgagcccaacttatcagatgaggagatacaggtggacgattgaaagtgaagctgctgcccagccctggattttagggccctggaccccctgctagaggccttgtctgggttcccgggtggagggtaaacacccatttagctctgttctgtctcttactccacactcctacttttcttactcgttaaagaataaagccgccactctgctgctgcaa

//