LOCUS       NM_008274               2534 bp    mRNA    linear   ROD 15-JUL-2024
DEFINITION  Mus musculus homeobox D12 (Hoxd12), mRNA.
ACCESSION   NM_008274
VERSION     NM_008274.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 2534)
  AUTHORS   Charng,W.L., Nikolov,M., Shrestha,I., Seeley,M.A., Josyula,N.S.,
            Justice,A.E., Dobbs,M.B. and Gurnett,C.A.
  TITLE     Exome sequencing of 1190 non-syndromic clubfoot cases reveals
            HOXD12 as a novel disease gene
  JOURNAL   J Med Genet 61 (7), 699-706 (2024)
   PUBMED   38663984
  REMARK    GeneRIF: Exome sequencing of 1190 non-syndromic clubfoot cases
            reveals HOXD12 as a novel disease gene.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2534)
  AUTHORS   Chen,Y., Zhou,T., Liao,Z., Gao,W., Wu,J., Zhang,S., Li,Y., Liu,H.,
            Zhou,H., Xu,C. and Su,P.
  TITLE     Hnrnpk is essential for embryonic limb bud development as a
            transcription activator and a collaborator of insulator protein
            Ctcf
  JOURNAL   Cell Death Differ 30 (10), 2293-2308 (2023)
   PUBMED   37608075
REFERENCE   3  (bases 1 to 2534)
  AUTHORS   Kumar,S., Alam,S.S., Bareke,E., Beauchamp,M.C., Dong,Y., Chan,W.,
            Majewski,J. and Jerome-Majewska,L.A.
  TITLE     Sf3b4 regulates chromatin remodeler splicing and Hox expression
  JOURNAL   Differentiation 131, 59-73 (2023)
   PUBMED   37167859
REFERENCE   4  (bases 1 to 2534)
  AUTHORS   Chang,Y.C., Manent,J., Schroeder,J., Wong,S.F.L., Hauswirth,G.M.,
            Shylo,N.A., Moore,E.L., Achilleos,A., Garside,V., Polo,J.M.,
            Trainor,P. and McGlinn,E.
  TITLE     Nr6a1 controls Hox expression dynamics and is a master regulator of
            vertebrate trunk development
  JOURNAL   Nat Commun 13 (1), 7766 (2022)
   PUBMED   36522318
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 2534)
  AUTHORS   Bolt,C.C., Lopez-Delisle,L., Hintermann,A., Mascrez,B., Rauseo,A.,
            Andrey,G. and Duboule,D.
  TITLE     Context-dependent enhancer function revealed by targeted inter-TAD
            relocation
  JOURNAL   Nat Commun 13 (1), 3488 (2022)
   PUBMED   35715427
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 2534)
  AUTHORS   Chan,D.C., Wynshaw-Boris,A. and Leder,P.
  TITLE     Formin isoforms are differentially expressed in the mouse embryo
            and are required for normal expression of fgf-4 and shh in the limb
            bud
  JOURNAL   Development 121 (10), 3151-3162 (1995)
   PUBMED   7588050
REFERENCE   7  (bases 1 to 2534)
  AUTHORS   Dolle,P., Izpisua-Belmonte,J.C., Boncinelli,E. and Duboule,D.
  TITLE     The Hox-4.8 gene is localized at the 5' extremity of the Hox-4
            complex and is expressed in the most posterior parts of the body
            during development
  JOURNAL   Mech Dev 36 (1-2), 3-13 (1991)
   PUBMED   1685889
REFERENCE   8  (bases 1 to 2534)
  AUTHORS   Izpisua-Belmonte,J.C., Falkenstein,H., Dolle,P., Renucci,A. and
            Duboule,D.
  TITLE     Murine genes related to the Drosophila AbdB homeotic genes are
            sequentially expressed during development of the posterior part of
            the body
  JOURNAL   EMBO J 10 (8), 2279-2289 (1991)
   PUBMED   1676674
REFERENCE   9  (bases 1 to 2534)
  AUTHORS   Duboule,D., Boncinelli,E., DeRobertis,E., Featherstone,M.,
            Lonai,P., Oliver,G. and Ruddle,F.H.
  TITLE     An update of mouse and human HOX gene nomenclature
  JOURNAL   Genomics 7 (3), 458-459 (1990)
   PUBMED   1973145
REFERENCE   10 (bases 1 to 2534)
  AUTHORS   Dolle,P., Izpisua-Belmonte,J.C., Falkenstein,H., Renucci,A. and
            Duboule,D.
  TITLE     Coordinate expression of the murine Hox-5 complex
            homoeobox-containing genes during limb pattern formation
  JOURNAL   Nature 342 (6251), 767-772 (1989)
   PUBMED   2574828
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL928644.12 and AK031206.1.
            
            On Aug 2, 2012 this sequence version replaced NM_008274.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK031206.1, BC145656.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849381, SAMN00849389
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-62                AL928644.12        159945-160006
            63-1482             AK031206.1         2-1421
            1483-1483           AL928644.12        161586-161586
            1484-2534           AK031206.1         1423-2473
FEATURES             Location/Qualifiers
     source          1..2534
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="2"
                     /map="2 44.13 cM"
     gene            1..2534
                     /gene="Hoxd12"
                     /gene_synonym="Hox-4.7; Hox-5.6"
                     /note="homeobox D12"
                     /db_xref="GeneID:15432"
                     /db_xref="MGI:MGI:96204"
     exon            1..642
                     /gene="Hoxd12"
                     /gene_synonym="Hox-4.7; Hox-5.6"
                     /inference="alignment:Splign:2.1.0"
     CDS             75..881
                     /gene="Hoxd12"
                     /gene_synonym="Hox-4.7; Hox-5.6"
                     /note="homeobox protein Hox-4.7; homeobox protein Hox-5.6;
                     homeo box D12"
                     /codon_start=1
                     /product="homeobox protein Hox-D12"
                     /protein_id="NP_032300.2"
                     /db_xref="CCDS:CCDS38147.1"
                     /db_xref="GeneID:15432"
                     /db_xref="MGI:MGI:96204"
                     /translation="

MCERSLYRAGYVGSLLNLQSPDSFYFSNLRANGSQLAALPPISYPRSALPWATTPASCTPAQPATASAFGGFSQPYLTGSGPIGLQSPGAKDGPEDQVKFYTPDAPTASEERSRTRPPFAPESSLVHSALKGTKYDYAGVGRTAPGSATLLQGAPCASSFKEDTKGPLNLNMAVQVAGVASCLRSSLPDGLPWGAAPGRARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVQREQALALY"

     misc_feature    <183..443
                     /gene="Hoxd12"
                     /gene_synonym="Hox-4.7; Hox-5.6"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     misc_feature    378..446
                     /gene="Hoxd12"
                     /gene_synonym="Hox-4.7; Hox-5.6"
                     /note="propagated from UniProtKB/Swiss-Prot (P23812.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    675..845
                     /gene="Hoxd12"
                     /gene_synonym="Hox-4.7; Hox-5.6"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            643..2534
                     /gene="Hoxd12"
                     /gene_synonym="Hox-4.7; Hox-5.6"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

cctctgagcccgtcctcctattccgggttgtaactaaatactgttgcgagcacagccgaggccctttgttggagatgtgtgagcgcagtctctacagagctggctatgtgggctcgcttctgaatttacagtcaccggactctttctacttttccaacctgagagccaatggcagccagttggccgcgcttccccccatctcataccctcgcagcgcgctgccctgggctactacgcccgcctcatgcacccctgcgcagcctgccaccgcctctgcctttggaggcttctctcagccttacttgaccggctctgggccaattggcctgcagtctccaggcgccaaggacggacccgaagaccaggtcaagttctatacgcctgatgcgcccaccgcatctgaggaacgcagccggactaggccgcccttcgcccccgagtctagtctggttcattcggctctcaaaggcaccaagtatgactacgcgggtgtgggccggaccgctccaggctctgcgaccctgctccagggggccccctgtgcctccagcttcaaggaagacaccaaaggcccgctcaacttgaacatggcagtgcaagtggccggggtggcctcttgcctgcgatcttcactgcccgacggcctgccgtggggggcggccccggggagggcccgcaagaagaggaaaccctacacaaagcagcagattgcggagctggagaacgaattcctggtcaatgaattcatcaaccggcagaagcgtaaggaattgtctaacaggctgaacctcagcgaccagcaggtcaaaatctggttccagaaccggcgtatgaagaagaagcgggtagtgcagcgcgagcaagcactggccctctattagctgcccacgggggcctgaggccttgccaagcctgcccttttggaccaaggcctggctgtggaggaggtgttggggctgcagatttccctcccactcctctggtcctgggcgcccttcggctcagtctgtagctgaggaaccaggaggagatttggagatgaggccagtggagcccccttcgctttcagctctctttgggaccctcctgagaggtgtttgggaattgcaatctaacactggctttaaacattcagcatggtgtctgggggtcacctgtccttgtctatgatgtttacatccggggctcactattgaaacactgtatgagggtttgttttttccggttttcaacgtgttctttttctttttctttctctatccagctctttctgcatgaaacaggagcctagctagagctccgggtataagtgcaggtagaaaggccctgagaccccgctgcagtgcaaggggctggggataactctagccccttcgcagcagaagccctttgtgacaaagctgggctctccactctgcaggaaggaaagggcctgattccacaacccccatctgccctgaatgatttgggaggacaaaagctaccctagaccttcagacttgtggggggggggggaggaaaggataccctggaacctcagcgcttcaaaggttctcctgctgagtaaaacaggctggaagatctccttctcagagacagggagagaaactgggactccaaaacaaagtatggtctctagactgtcataattcccctgctccagcctcacctatccctgagccaaggccaagcactctgtaactagatccccagaactgagctatgggtgaggggagctgctggcctgttttgaggcttggctgcacagggaagaaagaagagtaagcgaggcggaggaggatctgcactctgtaaccacgactctcctcttgaatgaatgaagttatccatatgtctgtctttcttgaatttccttaatgtatcaccacaggaagagaccccccccccaaaaaaaatgcctccttgaggagtctgaagggtgggagaagaaacctctcagattctcagactgtagttgctgctcttgaaggacagaaaaccagcacttcttccccatcctctccaccacccaccaactccatcagaacttagctagggtgtctcttctcagagactggtggtcagctcttgtaaagcttttaaggccccaagccctgccaggtttaccttgagaaacctaggttttctgaattgtgaatgaagttgctctacgcctgttatagaatctgtccagcctcattcccagtgaattcaactccgccttcccctacaatctttgcctcttcttttgagctttaagccccacccccaacctttagcaagatgcacaacatcccaaaggctcatgattccttccccaagtccaatggctttcctttagagaaggtctccaggaactggacctcgaagggcatctcacaaggacctttgagcctcgccccaactgacctcggttggtgtgttaaatattatttcctgtgctaacagttgccgtttatgttttgttttgattttgtaaaataacacttccctgtatatattagcttcatagtgaaaataaatatccagatccc

//