GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-25 14:55:04, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_007498               1981 bp    mRNA    linear   ROD 10-DEC-2025
DEFINITION  Mus musculus activating transcription factor 3 (Atf3), mRNA.
ACCESSION   NM_007498
VERSION     NM_007498.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1981)
  AUTHORS   Baruch,E.N., Gleber-Netto,F.O., Nagarajan,P., Rao,X., Akhter,S.,
            Eichwald,T., Xie,T., Balood,M., Adewale,A., Naara,S.,
            Sathishkumar,H.N., Islam,S., McCarthy,W., Mattson,B.J.,
            Ferrarotto,R., Wong,M.K., Davies,M.A., Jindal,S., Basu,S.,
            Roversi,K., Nikpoor,A.R., Ahmadi,M., Ahmadi,A., Harwood,C.,
            Leigh,I., Gong,D., Tallon de Lara,P., Tao,D.L., Davidson,T.M.,
            Ajami,N.J., Futreal,A., Rai,K., Kochat,V., Castillo,M.,
            Gunaratne,P., Goepfert,R.P., Hernandez,S.D., Khushalani,N.I.,
            Wang,J., Watowich,S.S., Calin,G.A., Migden,M.R., Yuan,M., Liu,N.,
            Ye,Y., Hwang,W.L., Vermeer,P.D., D'Silva,N.J., Bunimovich,Y.L.,
            Yaniv,D., Burks,J.K., Gomez,J., Dougherty,P.M., Tsai,K.Y.,
            Allison,J.P., Sharma,P., Wargo,J.A., Myers,J.N., Talbot,S.,
            Gross,N.D. and Amit,M.
  TITLE     Cancer-induced nerve injury promotes resistance to anti-PD-1
            therapy
  JOURNAL   Nature 646 (8084), 462-473 (2025)
   PUBMED   40836096
REFERENCE   2  (bases 1 to 1981)
  AUTHORS   Lin,K., Ly,N., Kunjamma,R.B., Vu,N., King,B., Robb,H.M.,
            Mohler,E.G., Sridar,J., Hao,Q., Zavala-Solorio,J., Zhang,C.,
            Shahryari,V., van Bruggen,N., Connelly,C.F., Bennett,B.D., Lee,J.J.
            and Sidrauski,C.
  TITLE     Chronic integrated stress response causes dysregulated cholesterol
            synthesis in white matter disease
  JOURNAL   JCI Insight 10 (16), e188459 (2025)
   PUBMED   40674686
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1981)
  AUTHORS   Nguyen,L.D., Nguyen,L.H., Dao,D.X., Hattori,T., Takarada-Iemata,M.,
            Ishii,H., Tamatani,T., Kawasaki,H., Shinmyo,Y., Onoue,K.,
            Yonemura,S., Zhang,J., Miyake,M., Oyadomari,S., Mori,K. and Hori,O.
  TITLE     Impact of ATF6 deletion on the embryonic brain development
  JOURNAL   iScience 28 (6), 112569 (2025)
   PUBMED   40487428
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1981)
  AUTHORS   Encarnacion,J., Smith,D.M., Choi,J., Scafidi,J. and Wolfgang,M.J.
  TITLE     Activating transcription factor 3 regulates hepatic apolipoprotein
            A4 upon metabolic stress
  JOURNAL   J Biol Chem 301 (5), 108468 (2025)
   PUBMED   40158856
REFERENCE   5  (bases 1 to 1981)
  AUTHORS   Alkaslasi,M.R., Lloyd,E.Y.H., Gable,A.S., Silberberg,H.,
            Yarur,H.E., Tsai,V.S., Sohn,M., Margolin,G., Tejeda,H.A. and Le
            Pichon,C.E.
  TITLE     The transcriptional response of cortical neurons to concussion
            reveals divergent fates after injury
  JOURNAL   Nat Commun 16 (1), 1097 (2025)
   PUBMED   39870620
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1981)
  AUTHORS   Allen-Jennings,A.E., Hartman,M.G., Kociba,G.J. and Hai,T.
  TITLE     The roles of ATF3 in glucose homeostasis. A transgenic mouse model
            with liver dysfunction and defects in endocrine pancreas
  JOURNAL   J Biol Chem 276 (31), 29507-29514 (2001)
   PUBMED   11371557
REFERENCE   7  (bases 1 to 1981)
  AUTHORS   Okamoto,Y., Chaves,A., Chen,J., Kelley,R., Jones,K., Weed,H.G.,
            Gardner,K.L., Gangi,L., Yamaguchi,M., Klomkleaw,W., Nakayama,T.,
            Hamlin,R.L., Carnes,C., Altschuld,R., Bauer,J. and Hai,T.
  TITLE     Transgenic mice with cardiac-specific expression of activating
            transcription factor 3, a stress-inducible gene, have conduction
            abnormalities and contractile dysfunction
  JOURNAL   Am J Pathol 159 (2), 639-650 (2001)
   PUBMED   11485922
REFERENCE   8  (bases 1 to 1981)
  AUTHORS   Drysdale,B.E., Howard,D.L. and Johnson,R.J.
  TITLE     Identification of a lipopolysaccharide inducible transcription
            factor in murine macrophages
  JOURNAL   Mol Immunol 33 (11-12), 989-998 (1996)
   PUBMED   8960123
REFERENCE   9  (bases 1 to 1981)
  AUTHORS   Ishiguro,T., Nakajima,M., Naito,M., Muto,T. and Tsuruo,T.
  TITLE     Identification of genes differentially expressed in B16 murine
            melanoma sublines with different metastatic potentials
  JOURNAL   Cancer Res 56 (4), 875-879 (1996)
   PUBMED   8631027
REFERENCE   10 (bases 1 to 1981)
  AUTHORS   Hai,T.W., Liu,F., Coukos,W.J. and Green,M.R.
  TITLE     Transcription factor ATF cDNA clones: an extensive family of
            leucine zipper proteins able to selectively form DNA-binding
            heterodimers
  JOURNAL   Genes Dev 3 (12B), 2083-2090 (1989)
   PUBMED   2516827
  REMARK    Erratum:[Genes Dev 1990 Apr;4(4):682]
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AK133965.1 and BE199676.1.
            
            On Nov 15, 2007 this sequence version replaced NM_007498.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC019946.1, AK133965.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164138, SAMN02415122
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1964              AK133965.1         5-1968
            1965-1981           BE199676.1         1-17                c
FEATURES             Location/Qualifiers
     source          1..1981
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="1"
                     /map="1 96.28 cM"
     gene            1..1981
                     /gene="Atf3"
                     /gene_synonym="LRG-21"
                     /note="activating transcription factor 3"
                     /db_xref="GeneID:11910"
                     /db_xref="MGI:MGI:109384"
     exon            1..241
                     /gene="Atf3"
                     /gene_synonym="LRG-21"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    138..140
                     /gene="Atf3"
                     /gene_synonym="LRG-21"
                     /note="upstream in-frame stop codon"
     exon            242..485
                     /gene="Atf3"
                     /gene_synonym="LRG-21"
                     /inference="alignment:Splign:2.1.0"
     CDS             246..791
                     /gene="Atf3"
                     /gene_synonym="LRG-21"
                     /note="transcription factor LRG-21; cAMP-dependent
                     transcription factor ATF-3"
                     /codon_start=1
                     /product="cyclic AMP-dependent transcription factor ATF-3"
                     /protein_id="NP_031524.2"
                     /db_xref="CCDS:CCDS15616.1"
                     /db_xref="GeneID:11910"
                     /db_xref="MGI:MGI:109384"
                     /translation="
MMLQHPGQVSASEVSATAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVNNRPLEMSVTKSEAAPEEDERKRRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS"
     misc_feature    462..536
                     /gene="Atf3"
                     /gene_synonym="LRG-21"
                     /note="propagated from UniProtKB/Swiss-Prot (Q60765.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    507..575
                     /gene="Atf3"
                     /gene_synonym="LRG-21"
                     /note="propagated from UniProtKB/Swiss-Prot (Q60765.1);
                     Region: Basic motif.
                     /evidence=ECO:0000255|PROSITE-ProRule:PRU00978"
     misc_feature    531..692
                     /gene="Atf3"
                     /gene_synonym="LRG-21"
                     /note="Basic leucine zipper (bZIP) domain of Activating
                     Transcription Factor-3 (ATF-3) and similar proteins: a
                     DNA-binding and dimerization domain; Region: bZIP_ATF3;
                     cd14722"
                     /db_xref="CDD:269870"
     misc_feature    531..683
                     /gene="Atf3"
                     /gene_synonym="LRG-21"
                     /note="coiled coil [structural motif]; Region: coiled
                     coil"
                     /db_xref="CDD:269870"
     misc_feature    order(564..566,573..578,585..590,594..599,606..611,
                     615..620,627..632,636..641,648..653,657..662,669..674,
                     678..683)
                     /gene="Atf3"
                     /gene_synonym="LRG-21"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:269870"
     misc_feature    585..671
                     /gene="Atf3"
                     /gene_synonym="LRG-21"
                     /note="propagated from UniProtKB/Swiss-Prot (Q60765.1);
                     Region: Leucine-zipper.
                     /evidence=ECO:0000255|PROSITE-ProRule:PRU00978"
     misc_feature    729..731
                     /gene="Atf3"
                     /gene_synonym="LRG-21"
                     /note="Phosphothreonine.
                     /evidence=ECO:0000250|UniProtKB:P18847; propagated from
                     UniProtKB/Swiss-Prot (Q60765.1); phosphorylation site"
     exon            486..593
                     /gene="Atf3"
                     /gene_synonym="LRG-21"
                     /inference="alignment:Splign:2.1.0"
     exon            594..1977
                     /gene="Atf3"
                     /gene_synonym="LRG-21"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1950..1955
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Atf3"
                     /gene_synonym="LRG-21"
                     /note="hexamer: AATAAA"
     polyA_site      1977
                     /gene="Atf3"
                     /gene_synonym="LRG-21"
                     /note="major polyA site"
ORIGIN      
ctgggattggtaacctggagttaagcgggctccctgccaacgcgagggctttaaaaggggtgatgcaacgcgctcccagccacagtctcactcagcgagacgccgcgcacggtgcttccccagtggagccaatcggctaacccgcgctccggcagagtccttggcgctcgcccgccggcgggacagaccacccgcctctggccgctctctggaccctggccgccccgagcgaagactggagcaaaatgatgcttcaacatccaggccaggtctctgcctcagaagtcagtgcgaccgccattgtcccctgcctctcacctcctgggtcactggtatttgaggattttgctaacctgacaccctttgtcaaggaagagctgagattcgccatccagaataaacacctctgccatcggatgtcctctgcgctggagtcagttaccgtcaacaacagacccctggagatgtcagtcaccaagtctgaggcggcccctgaagaagatgagaggaaaaggaggcggcgagaaagaaataaaattgctgctgccaagtgtcgaaacaagaaaaaggagaagacagagtgcctgcagaaagagtcagagaaactggagagtgtgaatgctgagctgaaggcccagattgaggagctgaagaatgagaaacagcatttgatatacatgctcaacctgcaccggcccacctgcatcgtccgggctcagaatggacggacaccggaagacgagaggaacctctttatccaacagataaaagaaggaacattgcagagctaagcagaggtggcacggaggcaattggggagttcttactgaatcctccttttccaccccacaccctgaagccattggaaaactggcttcctgtgcacttctagaatcccagcagccaagagccgttggggcaggagggcctgtggtgacctactgcattgacccactctgcccccgagtgaaccgtggagcaggcaggagcatcctttgtctcaccaattccaggatttaggccttatcatcccggccagtctcagatgacctagctggccccaggctggggtcctatgcaaagcaggatcccactaatgggattcaggcagaagtgtctaccttgataggtggggtgggaccacatcctccactgtggctgacaacgcccttccaagggaatatggaatgagaacattcattattgaggttgtccaatggccagggtatgctttctagaaaatatgctgttctgtcccagaatgactgtgcatagggtatccgtttcagagcctggtgttgtgctatttagatgtttgtcttgcacaacattggcatgatttttccgggagtttcatcagatctgatttctgagagtctggggatctgccatggtggaaagtgcccctcaaaagcatttgtgtggccacatgaactggctggcaccaggggagtgaaactggctgatgaccagctgagccactttgtgccaacagaggatggacgacacctttccctgtacccactgcagaggaagaaccctgggcacagcagctttgtccttggctacaaactgttacaacgtcacacaatgaaggcacaaagtccaactttcaaagggtgtaggactccatactcagtgacagggcaggaagagccaaagataaccacagccacagcctgtggagaccagggttggaagccaggtgcagggccaggcatctgcattgtgggatgttaatggcacttttgtcttgtagctattttgagatgtggtccagagcatttcagctgggagatctccctctggccaccaggactctggctactgttaaaatcctgatgtttctgtggaatcctcagtgtttaatcccactcaatagtatcattacagttttctgtaagagaaaatattacttatttatcccagtattcctagcctgtcaacataataaatatcggaacaaaacctggtaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]