2025-04-24 07:52:43, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001360728 697 bp mRNA linear ROD 02-MAY-2024 DEFINITION Mus musculus interferon induced transmembrane protein 1 (Ifitm1), transcript variant 4, mRNA. ACCESSION NM_001360728 VERSION NM_001360728.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 697) AUTHORS Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A., Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R., Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J., Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z., Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J., Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L., Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J., Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B., Jackson,S.P. and Balmus,G. CONSRTM Sanger Mouse Genetics Project TITLE Genetic determinants of micronucleus formation in vivo JOURNAL Nature 627 (8002), 130-136 (2024) PUBMED 38355793 REFERENCE 2 (bases 1 to 697) AUTHORS Zhang,X., Yuan,S., Li,H., Zhan,J., Wang,F., Fan,J., Nie,X., Wang,Y., Wen,Z., Chen,Y., Chen,C. and Wang,D.W. TITLE The double face of miR-320: cardiomyocytes-derived miR-320 deteriorated while fibroblasts-derived miR-320 protected against heart failure induced by transverse aortic constriction JOURNAL Signal Transduct Target Ther 6 (1), 69 (2021) PUBMED 33597502 REMARK GeneRIF: The double face of miR-320: cardiomyocytes-derived miR-320 deteriorated while fibroblasts-derived miR-320 protected against heart failure induced by transverse aortic constriction. Publication Status: Online-Only REFERENCE 3 (bases 1 to 697) AUTHORS Chal,J., Al Tanoury,Z., Oginuma,M., Moncuquet,P., Gobert,B., Miyanari,A., Tassy,O., Guevara,G., Hubaud,A., Bera,A., Sumara,O., Garnier,J.M., Kennedy,L., Knockaert,M., Gayraud-Morel,B., Tajbakhsh,S. and Pourquie,O. TITLE Recapitulating early development of mouse musculoskeletal precursors of the paraxial mesoderm in vitro JOURNAL Development 145 (6) (2018) PUBMED 29555813 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 697) AUTHORS Patoine,A., Husseini,A., Kasaai,B., Gaumond,M.H. and Moffatt,P. TITLE The osteogenic cell surface marker BRIL/IFITM5 is dispensable for bone development and homeostasis in mice JOURNAL PLoS One 12 (9), e0184568 (2017) PUBMED 28880886 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 697) AUTHORS Fu,B., Wang,L., Li,S. and Dorf,M.E. TITLE ZMPSTE24 defends against influenza and other pathogenic viruses JOURNAL J Exp Med 214 (4), 919-929 (2017) PUBMED 28246125 REFERENCE 6 (bases 1 to 697) AUTHORS Yang,G., Xu,Y., Chen,X. and Hu,G. TITLE IFITM1 plays an essential role in the antiproliferative action of interferon-gamma JOURNAL Oncogene 26 (4), 594-603 (2007) PUBMED 16847454 REMARK GeneRIF: The antiproliferative action of IFN-gamma requires the induction of IFITM1. REFERENCE 7 (bases 1 to 697) AUTHORS Tanaka,S.S., Yamaguchi,Y.L., Tsoi,B., Lickert,H. and Tam,P.P. TITLE IFITM/Mil/fragilis family proteins IFITM1 and IFITM3 play distinct roles in mouse primordial germ cell homing and repulsion JOURNAL Dev Cell 9 (6), 745-756 (2005) PUBMED 16326387 REFERENCE 8 (bases 1 to 697) AUTHORS Lickert,H., Cox,B., Wehrle,C., Taketo,M.M., Kemler,R. and Rossant,J. TITLE Dissecting Wnt/beta-catenin signaling during gastrulation using RNA interference in mouse embryos JOURNAL Development 132 (11), 2599-2609 (2005) PUBMED 15857914 REMARK GeneRIF: Fragilis2 regulates epithelialization of the somites and paraxial mesoderm formation. REFERENCE 9 (bases 1 to 697) AUTHORS Lange,U.C., Saitou,M., Western,P.S., Barton,S.C. and Surani,M.A. TITLE The fragilis interferon-inducible gene family of transmembrane proteins is associated with germ cell specification in mice JOURNAL BMC Dev Biol 3, 1 (2003) PUBMED 12659663 REFERENCE 10 (bases 1 to 697) AUTHORS Tanaka,S.S. and Matsui,Y. TITLE Developmentally regulated expression of mil-1 and mil-2, mouse interferon-induced transmembrane protein like genes, during formation and differentiation of primordial germ cells JOURNAL Mech Dev 119 Suppl 1, S261-S267 (2002) PUBMED 14516695 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC162287.4. Transcript Variant: This variant (4) uses an alternate splice junction in the 3' end compared to variant 2, that causes a frameshift. The resulting isoform (b) has a shorter and distinct C-terminus compared to isoform a. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: CA468402.1, ERR2844020.690380.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849374, SAMN00849375 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-363 AC162287.4 146401-146763 364-697 AC162287.4 147819-148152 FEATURES Location/Qualifiers source 1..697 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="7" /map="7 86.2 cM" gene 1..697 /gene="Ifitm1" /gene_synonym="1110036C17Rik; DSPA2a; Mil-2; Mil2" /note="interferon induced transmembrane protein 1" /db_xref="GeneID:68713" /db_xref="MGI:MGI:1915963" exon 1..363 /gene="Ifitm1" /gene_synonym="1110036C17Rik; DSPA2a; Mil-2; Mil2" /inference="alignment:Splign:2.1.0" misc_feature 58..60 /gene="Ifitm1" /gene_synonym="1110036C17Rik; DSPA2a; Mil-2; Mil2" /note="upstream in-frame stop codon" CDS 181..384 /gene="Ifitm1" /gene_synonym="1110036C17Rik; DSPA2a; Mil-2; Mil2" /note="isoform b is encoded by transcript variant 4; interferon induced transmembrane protein 2 like; fragilis2; fragilis protein 2; ifitm-like protein 2; dispanin subfamily A member 2a" /codon_start=1 /product="interferon-induced transmembrane protein 1 isoform b" /protein_id="NP_001347657.1" /db_xref="GeneID:68713" /db_xref="MGI:MGI:1915963" /translation="
MPKEQQEVVVLGSPHISTSATATTINMPEISTPDHVVWSLFNTLFMNFCCLGFVAYAYSVKGQEDGG"
misc_feature 277..>363 /gene="Ifitm1" /gene_synonym="1110036C17Rik; DSPA2a; Mil-2; Mil2" /note="Interferon-induced transmembrane protein; Region: CD225; pfam04505" /db_xref="CDD:461336" exon 364..697 /gene="Ifitm1" /gene_synonym="1110036C17Rik; DSPA2a; Mil-2; Mil2" /inference="alignment:Splign:2.1.0" ORIGIN
ttaactccgcagcccctaaaaagcacaccaaattgtaaacataaggaagtaggtttctgagaaacagaccccactggaggaaaaaggccggcccactgcgcagcaggctccggactgcccagtttgaaaagccttctcattccttccttattctcactctgcagcttcaaaagccgagagatgcctaaggagcagcaagaggtggttgtactggggtcaccccacatctcaacttctgcgacagccaccacaatcaacatgcctgagatctccacgcctgaccatgtggtctggtccctgttcaatacactcttcatgaacttctgctgcctgggcttcgtagcctatgcctactccgtgaagggacaggaagatggtgggtgatacgactggggcccaggccttcgcctccaccgccaagtgcctgaacatcagctccctgttcttcaccatcctcacggccatcgtcgtcatcgttgtctgtgccattagatgatgtgagatgtcttgcaacatctcacagtagataacagattctggggcctcccaggcttgctatgtgtttccttgtctatcgctgccccaaaccctagacttagtcctgaccatttgccccatacatatgcaaatgtgacactcacaaatctgtccatggtggactcaataaagtgcacgtgctgtgactttctgcccctgg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]