GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-06 10:59:32, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001306218            1539 bp    mRNA    linear   ROD 07-AUG-2023
DEFINITION  Mus musculus trafficking protein particle complex 6B (Trappc6b),
            transcript variant 3, mRNA.
ACCESSION   NM_001306218 XM_006516373
VERSION     NM_001306218.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1539)
  AUTHORS   Kim JJ, Lipatova Z and Segev N.
  TITLE     TRAPP Complexes in Secretion and Autophagy
  JOURNAL   Front Cell Dev Biol 4, 20 (2016)
   PUBMED   27066478
  REMARK    Review article
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1539)
  AUTHORS   Pan J, Mor G, Ju W, Zhong J, Luo X, Aldo PB, Zhong M, Yu Y, Jenkins
            EC, Brown WT and Zhong N.
  TITLE     Viral Infection-Induced Differential Expression of LncRNAs
            Associated with Collagen in Mouse Placentas and Amniotic Sacs
  JOURNAL   Am J Reprod Immunol 74 (3), 237-257 (2015)
   PUBMED   26073538
REFERENCE   3  (bases 1 to 1539)
  AUTHORS   Hughes DS, Keynes RJ and Tannahill D.
  TITLE     Extensive molecular differences between anterior- and
            posterior-half-sclerotomes underlie somite polarity and spinal
            nerve segmentation
  JOURNAL   BMC Dev Biol 9, 30 (2009)
   PUBMED   19463158
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1539)
  AUTHORS   Evsikov AV, Graber JH, Brockman JM, Hampl A, Holbrook AE, Singh P,
            Eppig JJ, Solter D and Knowles BB.
  TITLE     Cracking the egg: molecular dynamics and evolutionary aspects of
            the transition from the fully grown oocyte to embryo
  JOURNAL   Genes Dev 20 (19), 2713-2727 (2006)
   PUBMED   17015433
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DV660612.1, AK020026.1, AC153654.4 and CO039101.1.
            
            On Apr 16, 2015 this sequence version replaced XM_006516373.2.
            
            Transcript Variant: This variant (3) contains an alternate exon in
            its 5' UTR and initiates translation at a downstream in-frame start
            codon, compared to variant 1. The encoded isoform (3) has a shorter
            N-terminus compared to isoform 1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK168294.1, SRR5286963.54398.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849382, SAMN01164131
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-68                DV660612.1         16-83
            69-317              AK020026.1         38-286
            318-573             AC153654.4         22800-23055
            574-1332            AK020026.1         287-1045
            1333-1539           CO039101.1         1-207               c
FEATURES             Location/Qualifiers
     source          1..1539
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="12"
                     /map="12 25.99 cM"
     gene            1..1539
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /note="trafficking protein particle complex 6B"
                     /db_xref="GeneID:78232"
                     /db_xref="MGI:MGI:1925482"
     exon            1..317
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            318..573
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    490..492
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /note="upstream in-frame stop codon"
     exon            574..641
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /inference="alignment:Splign:2.1.0"
     CDS             607..969
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /note="isoform 3 is encoded by transcript variant 3;
                     trafficking protein particle complex subunit 6B; TRAPP
                     complex subunit 6B"
                     /codon_start=1
                     /product="trafficking protein particle complex subunit 6B
                     isoform 3"
                     /protein_id="NP_001293147.1"
                     /db_xref="GeneID:78232"
                     /db_xref="MGI:MGI:1925482"
                     /translation="
MGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLIQLSAGKQYLEHASKYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKFQVMIQKL"
     misc_feature    <607..960
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /note="Trs33 subunit of the TRAPP complex; Region:
                     TRAPPC6A_Trs33; cd14944"
                     /db_xref="CDD:271347"
     exon            642..759
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            760..843
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            844..937
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            938..1522
                     /gene="Trappc6b"
                     /gene_synonym="5830498C14Rik"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ggaagtggctcaggctccacgcccagcgctatagtcttggcagagtgtggggctgtcacagggtctctagggcccagtggcggcggccccggggaggggcgcggtccacggcggccttccgcggccttaggacccgggtaggccgctgagcacggcgtgcggtgggcgcggggtaacgggaacctcgagtcccgcactgatcggagccgactcggcgctggagggatcggcgggaaatggcggacgaggcgttgtttttgcttctccataacgagatggtgtccggagtgtacaagtccgccgagcagggggaagtgcattccatggccggacccagaggtgctgacggtgatggtgcagctcatcaccctcatcttcagagatctccaaggagacctgagactcaggctcggctgtatgagcaagtatgcagatagagcagacagcatgctgttattgcctttgatgaatacatggaactccatcagatgatgcggaaaacattctcagagtgaaaaacacagcaaggtctcatcatactcaaaatatccatctgctacaaagtgtttccaggaaaatggaaggtgtgttactaagctggagagcatggggttccgagtggggcaaggactgatagaaaggtttacgaaagatactgcaaggttcaaggatgaattagacatcatgaagttcatctgtaaagatttttggactacagtattcaagaaacagattgacaatctgaggacaaatcatcagggcatatatgtacttcaggacaacaaatttcgactactcattcagctgtctgcaggaaaacagtatttagaacatgcgtccaagtatctagcattcacatgtggcttaatcagaggtggtttgtcgaacttgggaataaaaagtattgtaacagctgaagtctcttcaatgcctgcctgcaaatttcaggtgatgatacagaagctgtagagcgagctggcgactcctgggcagagcgttgcacatcctgatttcacctcatcgttggttatctgcgttggagcaaatcgttatctcaccagagtcacatagaccaaatcaaagtagacacaggtcctttgaccatgacagaaactgactgacctattcagtgatttcagagaactagacaccaagatgcaaggctcttcattttaaacatctttatttccataggtgattagcatttaaccatcaataggaagtgaaactcagggtgtgttgaattgctgtattaaaaaaaatgcaccaatcagaatagtttgtgttcaaatgaccaaaatttgttgaactataaatctgttttagttatttaaaaaagcaaaccactatgttaaattaagcttaatttttattgtattgcttataatttatttctgtcgagagaattcatatgcttatgtaaggatatcatttatacattgtgtatatatgtgtatatataaatacatgcattactgtctaaattacttgaaagtttattttaatagacttgagtccttgaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]