2024-05-06 16:01:07, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001114153 800 bp mRNA linear ROD 07-AUG-2023 DEFINITION Mus musculus reproductive homeobox 2G (Rhox2g), mRNA. ACCESSION NM_001114153 XM_486662 VERSION NM_001114153.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 800) AUTHORS MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and Wilkinson,M.F. TITLE Rhox homeobox gene cluster: recent duplication of three family members JOURNAL Genesis 44 (3), 122-129 (2006) PUBMED 16496311 REFERENCE 2 (bases 1 to 800) AUTHORS Morris L, Gordon J and Blackburn CC. TITLE Identification of a tandem duplicated array in the Rhox alpha locus on mouse chromosome X JOURNAL Mamm Genome 17 (2), 178-187 (2006) PUBMED 16465597 REFERENCE 3 (bases 1 to 800) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL808133.17. On Feb 1, 2008 this sequence version replaced XM_486662.3. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: SRR5189685.225673.1, SRR17253012.5291312.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164134 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-111 AL808133.17 123158-123268 c 112-523 AL808133.17 122584-122995 c 524-569 AL808133.17 120955-121000 c 570-800 AL808133.17 118910-119140 c FEATURES Location/Qualifiers source 1..800 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="X" /map="X 21.94 cM" gene 1..800 /gene="Rhox2g" /gene_synonym="EG434766; Rhox2.7; Rhox2f" /note="reproductive homeobox 2G" /db_xref="GeneID:434766" /db_xref="MGI:MGI:3648776" exon 1..111 /gene="Rhox2g" /gene_synonym="EG434766; Rhox2.7; Rhox2f" /inference="alignment:Splign:2.1.0" CDS 45..620 /gene="Rhox2g" /gene_synonym="EG434766; Rhox2.7; Rhox2f" /note="reproductive homeobox 2F" /codon_start=1 /product="reproductive homeobox 2G" /protein_id="NP_001107625.1" /db_xref="CCDS:CCDS53059.1" /db_xref="GeneID:434766" /db_xref="MGI:MGI:3648776" /translation="
MERQSINYKLDVGPEEDEENANGIKTLMVLLAGEGRNEGESGRGLPGSGVSAAEGYRAGELSAGGLAAPVADLMDNNNQEDLGATGCAQEKEKQPEEPVPDSMGDLENVKPMSGPWSTVNPVRVLVPEFLHGWQQSFNVLQLQELESIFQCNHYISTTEAKCLARSMGVSKATVQEWFLKRREKYRSYKRL"
misc_feature 444..602 /gene="Rhox2g" /gene_synonym="EG434766; Rhox2.7; Rhox2f" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" misc_feature order(450..452,570..572,579..584,591..593) /gene="Rhox2g" /gene_synonym="EG434766; Rhox2.7; Rhox2f" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 112..523 /gene="Rhox2g" /gene_synonym="EG434766; Rhox2.7; Rhox2f" /inference="alignment:Splign:2.1.0" exon 524..569 /gene="Rhox2g" /gene_synonym="EG434766; Rhox2.7; Rhox2f" /inference="alignment:Splign:2.1.0" exon 570..800 /gene="Rhox2g" /gene_synonym="EG434766; Rhox2.7; Rhox2f" /inference="alignment:Splign:2.1.0" ORIGIN
tgagaggtgtaacagtgaataacgacttccacggctttacagacatggagcgacaaagcatcaattacaagcttgatgtgggacctgaggaggatgaggaaaatgcgaatggtataaagactctgatggtgttgctggctggagagggaagaaacgagggagagagtggacggggcctgcctgggtcgggagtctcagcagcggaaggatacagagcaggagaattaagtgcaggtgggcttgctgcgccagtagccgacctcatggataacaacaaccaagaggaccttggtgccactggctgtgcccaggagaaggagaagcagccagaggagccagtccctgattccatgggggatttggaaaatgtaaagcctatgtcagggccgtggtccactgttaatcctgtgagagtgttggtgcctgaattccttcacggttggcaacagagcttcaatgtgctgcaactacaagagctggagagcatcttccagtgcaatcactacatcagcactacagaggcaaagtgtctggcaagatccatgggtgtgagtaaagccacagtgcaggaatggtttttgaagaggagagagaaatacaggagttataagaggctgtaaaggctcagaggtcctcttcctgcattccggagcatctctctgtgaaggctgtggagaagccccaggcagccacccatgctcaagtcactgtagacagatgatgttgtgccgccaaagtcctgttacaacacagttatctccttaatacttgtatttgcaataaagagctgaattctcaat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]