2024-05-06 11:50:39, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001099316 761 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus reproductive homeobox 2B (Rhox2b), mRNA. ACCESSION NM_001099316 XM_001474057 XM_001474076 VERSION NM_001099316.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 761) AUTHORS MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and Wilkinson,M.F. TITLE Rhox homeobox gene cluster: recent duplication of three family members JOURNAL Genesis 44 (3), 122-129 (2006) PUBMED 16496311 REFERENCE 2 (bases 1 to 761) AUTHORS Morris L, Gordon J and Blackburn CC. TITLE Identification of a tandem duplicated array in the Rhox alpha locus on mouse chromosome X JOURNAL Mamm Genome 17 (2), 178-187 (2006) PUBMED 16465597 REFERENCE 3 (bases 1 to 761) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BC049546.1. On or before Jul 25, 2007 this sequence version replaced XM_001474057.1, XM_001474076.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: BC049546.1, CA464891.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164142 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on expression, longest protein ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-761 BC049546.1 1-761 FEATURES Location/Qualifiers source 1..761 /organism="Mus musculus" /mol_type="mRNA" /db_xref="taxon:10090" /chromosome="X" /map="X 21.71 cM" gene 1..761 /gene="Rhox2b" /gene_synonym="Rhox2.2; Rhox2a" /note="reproductive homeobox 2B" /db_xref="GeneID:100039913" /db_xref="MGI:MGI:3770262" exon 1..73 /gene="Rhox2b" /gene_synonym="Rhox2.2; Rhox2a" /inference="alignment:Splign:2.1.0" CDS 7..582 /gene="Rhox2b" /gene_synonym="Rhox2.2; Rhox2a" /note="reproductive homeobox 2A" /codon_start=1 /product="reproductive homeobox 2B" /protein_id="NP_001092786.1" /db_xref="CCDS:CCDS53052.1" /db_xref="GeneID:100039913" /db_xref="MGI:MGI:3770262" /translation="
MERQSVNYKLDVGPEEDEENANGIKTLMVLLAGEGRNEGESGPGLPGSGASAAEGYRAGEISAGGPAAPVADLMDNSNQEDLGATGCDQEKEKQPEEPVPDSMGDLENVKHVSGPWSTVNPVRVLVPKFRHGWQQSFNVLQLQELESIFQCNHYISTKEANRLARSMGVSEATVQEWFLKRREKYRSYKRL"
misc_feature 406..564 /gene="Rhox2b" /gene_synonym="Rhox2.2; Rhox2a" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" misc_feature order(412..414,532..534,541..546,553..555) /gene="Rhox2b" /gene_synonym="Rhox2.2; Rhox2a" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 74..485 /gene="Rhox2b" /gene_synonym="Rhox2.2; Rhox2a" /inference="alignment:Splign:2.1.0" exon 486..531 /gene="Rhox2b" /gene_synonym="Rhox2.2; Rhox2a" /inference="alignment:Splign:2.1.0" exon 532..761 /gene="Rhox2b" /gene_synonym="Rhox2.2; Rhox2a" /inference="alignment:Splign:2.1.0" ORIGIN
acagacatggagcgacaaagcgtcaattacaagcttgatgtgggacctgaggaggatgaggaaaatgcgaatggtataaagactctgatggtcttgctggctggagagggaagaaatgagggagagagtggaccgggcctgcctgggtcgggagcctcagcagcggaaggatacagagcaggagaaataagtgcaggtgggcctgctgcgccagtagccgacctcatggataacagcaaccaagaggaccttggtgccactggctgtgaccaggagaaggagaagcagccagaggagccagtccctgattccatgggagatttggaaaatgtaaagcatgtgtccgggccgtggtccactgttaatcctgtgagagtgttggtgcccaaattccgccacggttggcaacagagcttcaatgtgctgcaactacaagagctggagagcatcttccagtgcaatcactacatcagcactaaggaggcaaatcgcctggcaagatccatgggagtgagtgaagccacagtgcaggaatggtttttgaagaggagagaaaaatacaggagttataagaggctgtaaatgctcagaggtcctcttcctgcttcccacagcatctctctgtgaaggctatggagaagccccagggatccacgcttcctcaaggcgccatagccagacgatgttttcccgccaaagtcctgttacaacacagttatctcctcaatacttgtattagcaataaagagctgaattctcca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]