2024-05-06 17:09:15, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001085348 779 bp mRNA linear ROD 07-AUG-2023 DEFINITION Mus musculus reproductive homeobox 2E (Rhox2e), mRNA. ACCESSION NM_001085348 XM_001474270 XM_001474291 VERSION NM_001085348.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 779) AUTHORS MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and Wilkinson,M.F. TITLE Rhox homeobox gene cluster: recent duplication of three family members JOURNAL Genesis 44 (3), 122-129 (2006) PUBMED 16496311 REFERENCE 2 (bases 1 to 779) AUTHORS Morris L, Gordon J and Blackburn CC. TITLE Identification of a tandem duplicated array in the Rhox alpha locus on mouse chromosome X JOURNAL Mamm Genome 17 (2), 178-187 (2006) PUBMED 16465597 REFERENCE 3 (bases 1 to 779) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL808133.17. On or before Dec 27, 2007 this sequence version replaced XM_001474270.1, XM_001474291.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: SRR5189685.318817.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849384, SAMN01164134 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on expression, longest protein ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-95 AL808133.17 10266-10360 96-507 AL808133.17 10523-10934 508-553 AL808133.17 19088-19133 554-779 AL808133.17 21382-21607 FEATURES Location/Qualifiers source 1..779 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="X" /map="X 21.83 cM" gene 1..779 /gene="Rhox2e" /gene_synonym="Rhox2.5; Rhox2d" /note="reproductive homeobox 2E" /db_xref="GeneID:100040016" /db_xref="MGI:MGI:3770272" exon 1..95 /gene="Rhox2e" /gene_synonym="Rhox2.5; Rhox2d" /inference="alignment:Splign:2.1.0" CDS 29..604 /gene="Rhox2e" /gene_synonym="Rhox2.5; Rhox2d" /note="reproductive homeobox 2D" /codon_start=1 /product="reproductive homeobox 2E" /protein_id="NP_001078817.1" /db_xref="CCDS:CCDS53055.1" /db_xref="GeneID:100040016" /db_xref="MGI:MGI:3770272" /translation="
MERQSVNYKLDVGPEEDEENANGVKTLMVLLAGEGRNEGESGRGLPGSGASAAEGYRAGEISAGGPAAPVADLMDNSNQEDLGATGCDQEKEKQPEEPVPDSMGDLENVKRVSGPWSTVNPVRVLVPEFRHGWQQSFNVLQLQELESIFQCNHYISTKEANRLARSMGVSEATVQEWFLKRREKYRSYKRL"
misc_feature 428..586 /gene="Rhox2e" /gene_synonym="Rhox2.5; Rhox2d" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" misc_feature order(434..436,554..556,563..568,575..577) /gene="Rhox2e" /gene_synonym="Rhox2.5; Rhox2d" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 96..507 /gene="Rhox2e" /gene_synonym="Rhox2.5; Rhox2d" /inference="alignment:Splign:2.1.0" exon 508..553 /gene="Rhox2e" /gene_synonym="Rhox2.5; Rhox2d" /inference="alignment:Splign:2.1.0" exon 554..779 /gene="Rhox2e" /gene_synonym="Rhox2.5; Rhox2d" /inference="alignment:Splign:2.1.0" ORIGIN
gaataaggacttccacggctttacagacatggagcgacaaagcgtcaattacaagcttgatgtgggacctgaggaggatgaggaaaatgcgaatggtgtaaagactctgatggtcttgctggctggagagggaagaaacgagggagagagtggacggggcctgcctgggtcgggagcctcagcagcggaaggatacagagcaggagaaataagtgcaggtgggcctgctgcgccagtagccgacctcatggataacagcaaccaagaggaccttggtgccactggctgtgaccaggagaaggagaagcagccagaggagccagtccctgattccatgggagatttggaaaatgtaaagcgtgtgtccgggccgtggtccactgttaatcctgtgagagtgttggtgcccgaattccgccacggttggcaacagagcttcaatgtgctgcaactacaagagctggagagcatcttccagtgcaatcactacatcagcactaaggaggcaaatcgcctggcaagatccatgggagtgagtgaagccacagtgcaggaatggtttttgaagaggagagaaaaatacaggagttataagaggctgtaaatgctcagaggtcctcttcctgcttcccacagcatctctctgtgaaggctatggagaagccccagggatccacgcttcctcaaggcgccatagccagacgatgttttcccgccaaagtcctgttacaacacagttatctcctcaatacttgtattagcaataaagagctgaattc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]