GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-07-03 03:12:46, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001033161            1385 bp    mRNA    linear   ROD 27-MAR-2025
DEFINITION  Mus musculus TNFRSF1A-associated via death domain (Tradd), mRNA.
ACCESSION   NM_001033161 XM_134502
VERSION     NM_001033161.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1385)
  AUTHORS   Soma,S., Murakami,K., Fukuchi,Y., Kunimoto,H. and Nakajima,H.
  TITLE     O-Linked N-Acetylglucosamine Transferase Ensures Survival of Mouse
            Fetal Liver Hematopoietic Progenitors Partly by Regulating Bcl-xL
            and Oxidative Phosphorylation
  JOURNAL   Stem Cells 42 (1), 55-63 (2024)
   PUBMED   37813816
REFERENCE   2  (bases 1 to 1385)
  AUTHORS   Gomez-Diaz,C., Jonsson,G., Schodl,K., Deszcz,L., Bestehorn,A.,
            Eislmayr,K., Almagro,J., Kavirayani,A., Seida,M., Fennell,L.M.,
            Hagelkruys,A., Kovarik,P., Penninger,J.M. and Ikeda,F.
  TITLE     The ubiquitin ligase HOIL-1L regulates immune responses by
            interacting with linear ubiquitin chains
  JOURNAL   iScience 24 (11), 103241 (2021)
   PUBMED   34755089
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1385)
  AUTHORS   Bedogni,F. and Hevner,R.F.
  TITLE     Cell-Type-Specific Gene Expression in Developing Mouse Neocortex:
            Intermediate Progenitors Implicated in Axon Development
  JOURNAL   Front Mol Neurosci 14, 686034 (2021)
   PUBMED   34321999
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1385)
  AUTHORS   Xu,D., Zhao,H., Jin,M., Zhu,H., Shan,B., Geng,J., Dziedzic,S.A.,
            Amin,P., Mifflin,L., Naito,M.G., Najafov,A., Xing,J., Yan,L.,
            Liu,J., Qin,Y., Hu,X., Wang,H., Zhang,M., Manuel,V.J., Tan,L.,
            He,Z., Sun,Z.J., Lee,V.M.Y., Wagner,G. and Yuan,J.
  TITLE     Modulating TRADD to restore cellular homeostasis and inhibit
            apoptosis
  JOURNAL   Nature 587 (7832), 133-138 (2020)
   PUBMED   32968279
  REMARK    GeneRIF: Modulating TRADD to restore cellular homeostasis and
            inhibit apoptosis.
REFERENCE   5  (bases 1 to 1385)
  AUTHORS   Feng,Q., Zhang,H., Nie,X., Li,Y., Chen,W.D. and Wang,Y.D.
  TITLE     miR-149* Suppresses Liver Cancer Progression by Down-Regulating
            Tumor Necrosis Factor Receptor 1-Associated Death Domain Protein
            Expression
  JOURNAL   Am J Pathol 190 (2), 469-483 (2020)
   PUBMED   31783009
  REMARK    GeneRIF: High TRADD expression promotes liver inflammatory response
            and liver carcinogenesis.
REFERENCE   6  (bases 1 to 1385)
  AUTHORS   Yamaoka,S., Courtois,G., Bessia,C., Whiteside,S.T., Weil,R.,
            Agou,F., Kirk,H.E., Kay,R.J. and Israel,A.
  TITLE     Complementation cloning of NEMO, a component of the IkappaB kinase
            complex essential for NF-kappaB activation
  JOURNAL   Cell 93 (7), 1231-1240 (1998)
   PUBMED   9657155
REFERENCE   7  (bases 1 to 1385)
  AUTHORS   Adam-Klages,S., Schwandner,R., Adam,D., Kreder,D., Bernardo,K. and
            Kronke,M.
  TITLE     Distinct adapter proteins mediate acid versus neutral
            sphingomyelinase activation through the p55 receptor for tumor
            necrosis factor
  JOURNAL   J Leukoc Biol 63 (6), 678-682 (1998)
   PUBMED   9620659
  REMARK    Review article
REFERENCE   8  (bases 1 to 1385)
  AUTHORS   Hsu,H., Shu,H.B., Pan,M.G. and Goeddel,D.V.
  TITLE     TRADD-TRAF2 and TRADD-FADD interactions define two distinct TNF
            receptor 1 signal transduction pathways
  JOURNAL   Cell 84 (2), 299-308 (1996)
   PUBMED   8565075
REFERENCE   9  (bases 1 to 1385)
  AUTHORS   Pan,M.G., Xiong,J., Copeland,N.G., Gilbert,D.J., Jenkins,N.A. and
            Goeddel,D.V.
  TITLE     Sequence, genomic organization, and chromosome localization of the
            mouse TRADD gene
  JOURNAL   J Inflamm 46 (3), 168-175 (1995)
   PUBMED   8844497
REFERENCE   10 (bases 1 to 1385)
  AUTHORS   Tebo,J.M., Chaoqun,W., Ohmori,Y. and Hamilton,T.A.
  TITLE     Murine inhibitory protein-kappa B alpha negatively regulates kappa
            B-dependent transcription in lipopolysaccharide-stimulated RAW
            264.7 macrophages
  JOURNAL   J Immunol 153 (10), 4713-4720 (1994)
   PUBMED   7963540
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AC124584.5 and
            AC124713.5.
            
            On Jan 12, 2007 this sequence version replaced NM_001033161.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK156540.1, BC138642.1 [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMN00849374,
                                           SAMN00849375 [ECO:0006172]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-34                AC124584.5         128885-128918
            35-193              AC124584.5         132799-132957
            194-471             AC124584.5         133492-133769
            472-664             AC124584.5         133850-134042
            665-1205            AC124584.5         134184-134724
            1206-1385           AC124713.5         184676-184855       c
FEATURES             Location/Qualifiers
     source          1..1385
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="8"
                     /map="8 53.04 cM"
     gene            1..1385
                     /gene="Tradd"
                     /gene_synonym="9130005N23Rik"
                     /note="TNFRSF1A-associated via death domain"
                     /db_xref="GeneID:71609"
                     /db_xref="MGI:MGI:109200"
     exon            1..34
                     /gene="Tradd"
                     /gene_synonym="9130005N23Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            35..193
                     /gene="Tradd"
                     /gene_synonym="9130005N23Rik"
                     /inference="alignment:Splign:2.1.0"
     CDS             43..975
                     /gene="Tradd"
                     /gene_synonym="9130005N23Rik"
                     /note="TNF receptor 1 associated signal transducer;
                     TNFR1-associated DEATH domain protein"
                     /codon_start=1
                     /product="tumor necrosis factor receptor type 1-associated
                     DEATH domain protein"
                     /protein_id="NP_001028333.1"
                     /db_xref="CCDS:CCDS22594.1"
                     /db_xref="GeneID:71609"
                     /db_xref="MGI:MGI:109200"
                     /translation="
MAAGQNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSESGDSSDVLQILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRAGAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGAIQVASAGSKFPVSSPTEEKPLPAACQTFLFHGQLVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCRALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLLGQAEPDGGLA"
     misc_feature    193..486
                     /gene="Tradd"
                     /gene_synonym="9130005N23Rik"
                     /note="TRADD, N-terminal domain; Region: TRADD_N;
                     pfam09034"
                     /db_xref="CDD:430379"
     misc_feature    481..531
                     /gene="Tradd"
                     /gene_synonym="9130005N23Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q3U0V2.1);
                     Region: Nuclear export signal.
                     /evidence=ECO:0000269|PubMed:22561347"
     misc_feature    679..945
                     /gene="Tradd"
                     /gene_synonym="9130005N23Rik"
                     /note="Death Domain of Tumor Necrosis Factor Receptor
                     1-Associated Death Domain protein; Region: Death_TRADD;
                     cd08780"
                     /db_xref="CDD:260050"
     misc_feature    700..903
                     /gene="Tradd"
                     /gene_synonym="9130005N23Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q3U0V2.1);
                     Region: Interaction with KRT14 and KRT18.
                     /evidence=ECO:0000250|UniProtKB:Q15628"
     misc_feature    727..768
                     /gene="Tradd"
                     /gene_synonym="9130005N23Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q3U0V2.1);
                     Region: Nuclear localization signal.
                     /evidence=ECO:0000269|PubMed:22561347"
     misc_feature    769..771
                     /gene="Tradd"
                     /gene_synonym="9130005N23Rik"
                     /note="(Microbial infection) N-beta-linked (GlcNAc)
                     arginine. /evidence=ECO:0000269|PubMed:30902834;
                     propagated from UniProtKB/Swiss-Prot (Q3U0V2.1);
                     glycosylation site"
     exon            194..471
                     /gene="Tradd"
                     /gene_synonym="9130005N23Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            472..664
                     /gene="Tradd"
                     /gene_synonym="9130005N23Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            665..1385
                     /gene="Tradd"
                     /gene_synonym="9130005N23Rik"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gcgcagcagagccaggcgagtgtgcggcggccaggaggcaagatggcagccggtcagaatggccacgaggagtgggtgggcagtgcatacctgtttttggagtctgcggtagacaaggtgatcctgtctgaagcctacacggatcccaagaagaaggtggcaatatacaaggctctgcagactgcactgtcagagagtggggacagctctgacgtactgcagatactcaagatccactgcagcgaccctcagctcatcgtccagttgcggttctgcgggcgcgtgctgtgcggccgcttcctccaagcctaccgcgagggggcgctgcgcaccgcgctgcagaggtgcatggccccggcgcttgcccaggaagcgctgcggttgcagctggagttgcgtgcaggtgcggagcagctggacagttggctgactgatgaagagcgctgtttgaattacatcttagcccagaagcccgaccggctcagggacgaggaactcgcggagctggaggatgagctctgcaaactgacgtgtgactgcactggccagggtggagccatacaggtagcttctgcaggttcgaagttcccggtttcctctccgaccgaggagaaaccactgccggccgcctgccagacttttctgttccacgggcagctcgtagtgaaccggccactgactcttcaagaccagcagacgtttgcgcgctcggtgggtctcaagtggcgcagggtggggcgctcgctgcagcgtaactgtcgggcactgagagatcctgccctcgactcgctggcctacgagtatgagcgtgatgggctatacgagcaggccttccagctgctgcgccgtttcatgcaagccgagggccgccgtgccacactgcagcgcctggtggaggcgctggaggagaacgaactcactagtctagcagaggatctgttgggccaggcggagccggatggcggcctggcctaagtctagtactgtggggaagggcggccaaccagcagttcagtgtttgaaacccacgggtggctgttggggtatttttttaccgctgatgttgctactgctgaccactttccatctactggacttggagagcatacgcacgccccacctagctgagctgctggagtgcaactaactgcccctccccccgccccccaggagccaggcaagcagcgcaggggtaaatcactgatgatcatacaaaaagaggacttgctgcaaagaccctctaagtacccggaccttctgaaacctagctcaaggtgctacaaaaactgtcgggagcaggatgcacgattttccccgcccttggcatatactcatcgtgggaccgaagcaccttgtctgcagcgataataaaatgtaactctttt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]