ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-07-03 03:12:46, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001033161 1385 bp mRNA linear ROD 27-MAR-2025
DEFINITION Mus musculus TNFRSF1A-associated via death domain (Tradd), mRNA.
ACCESSION NM_001033161 XM_134502
VERSION NM_001033161.2
KEYWORDS RefSeq; RefSeq Select.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 1385)
AUTHORS Soma,S., Murakami,K., Fukuchi,Y., Kunimoto,H. and Nakajima,H.
TITLE O-Linked N-Acetylglucosamine Transferase Ensures Survival of Mouse
Fetal Liver Hematopoietic Progenitors Partly by Regulating Bcl-xL
and Oxidative Phosphorylation
JOURNAL Stem Cells 42 (1), 55-63 (2024)
PUBMED 37813816
REFERENCE 2 (bases 1 to 1385)
AUTHORS Gomez-Diaz,C., Jonsson,G., Schodl,K., Deszcz,L., Bestehorn,A.,
Eislmayr,K., Almagro,J., Kavirayani,A., Seida,M., Fennell,L.M.,
Hagelkruys,A., Kovarik,P., Penninger,J.M. and Ikeda,F.
TITLE The ubiquitin ligase HOIL-1L regulates immune responses by
interacting with linear ubiquitin chains
JOURNAL iScience 24 (11), 103241 (2021)
PUBMED 34755089
REMARK Publication Status: Online-Only
REFERENCE 3 (bases 1 to 1385)
AUTHORS Bedogni,F. and Hevner,R.F.
TITLE Cell-Type-Specific Gene Expression in Developing Mouse Neocortex:
Intermediate Progenitors Implicated in Axon Development
JOURNAL Front Mol Neurosci 14, 686034 (2021)
PUBMED 34321999
REMARK Publication Status: Online-Only
REFERENCE 4 (bases 1 to 1385)
AUTHORS Xu,D., Zhao,H., Jin,M., Zhu,H., Shan,B., Geng,J., Dziedzic,S.A.,
Amin,P., Mifflin,L., Naito,M.G., Najafov,A., Xing,J., Yan,L.,
Liu,J., Qin,Y., Hu,X., Wang,H., Zhang,M., Manuel,V.J., Tan,L.,
He,Z., Sun,Z.J., Lee,V.M.Y., Wagner,G. and Yuan,J.
TITLE Modulating TRADD to restore cellular homeostasis and inhibit
apoptosis
JOURNAL Nature 587 (7832), 133-138 (2020)
PUBMED 32968279
REMARK GeneRIF: Modulating TRADD to restore cellular homeostasis and
inhibit apoptosis.
REFERENCE 5 (bases 1 to 1385)
AUTHORS Feng,Q., Zhang,H., Nie,X., Li,Y., Chen,W.D. and Wang,Y.D.
TITLE miR-149* Suppresses Liver Cancer Progression by Down-Regulating
Tumor Necrosis Factor Receptor 1-Associated Death Domain Protein
Expression
JOURNAL Am J Pathol 190 (2), 469-483 (2020)
PUBMED 31783009
REMARK GeneRIF: High TRADD expression promotes liver inflammatory response
and liver carcinogenesis.
REFERENCE 6 (bases 1 to 1385)
AUTHORS Yamaoka,S., Courtois,G., Bessia,C., Whiteside,S.T., Weil,R.,
Agou,F., Kirk,H.E., Kay,R.J. and Israel,A.
TITLE Complementation cloning of NEMO, a component of the IkappaB kinase
complex essential for NF-kappaB activation
JOURNAL Cell 93 (7), 1231-1240 (1998)
PUBMED 9657155
REFERENCE 7 (bases 1 to 1385)
AUTHORS Adam-Klages,S., Schwandner,R., Adam,D., Kreder,D., Bernardo,K. and
Kronke,M.
TITLE Distinct adapter proteins mediate acid versus neutral
sphingomyelinase activation through the p55 receptor for tumor
necrosis factor
JOURNAL J Leukoc Biol 63 (6), 678-682 (1998)
PUBMED 9620659
REMARK Review article
REFERENCE 8 (bases 1 to 1385)
AUTHORS Hsu,H., Shu,H.B., Pan,M.G. and Goeddel,D.V.
TITLE TRADD-TRAF2 and TRADD-FADD interactions define two distinct TNF
receptor 1 signal transduction pathways
JOURNAL Cell 84 (2), 299-308 (1996)
PUBMED 8565075
REFERENCE 9 (bases 1 to 1385)
AUTHORS Pan,M.G., Xiong,J., Copeland,N.G., Gilbert,D.J., Jenkins,N.A. and
Goeddel,D.V.
TITLE Sequence, genomic organization, and chromosome localization of the
mouse TRADD gene
JOURNAL J Inflamm 46 (3), 168-175 (1995)
PUBMED 8844497
REFERENCE 10 (bases 1 to 1385)
AUTHORS Tebo,J.M., Chaoqun,W., Ohmori,Y. and Hamilton,T.A.
TITLE Murine inhibitory protein-kappa B alpha negatively regulates kappa
B-dependent transcription in lipopolysaccharide-stimulated RAW
264.7 macrophages
JOURNAL J Immunol 153 (10), 4713-4720 (1994)
PUBMED 7963540
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from AC124584.5 and
AC124713.5.
On Jan 12, 2007 this sequence version replaced NM_001033161.1.
Sequence Note: The RefSeq transcript and protein were derived from
genomic sequence to make the sequence consistent with the reference
genome assembly. The genomic coordinates used for the transcript
record were based on alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AK156540.1, BC138642.1 [ECO:0000332]
RNAseq introns :: mixed sample support SAMN00849374,
SAMN00849375 [ECO:0006172]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on single protein-coding transcript
##RefSeq-Attributes-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-34 AC124584.5 128885-128918
35-193 AC124584.5 132799-132957
194-471 AC124584.5 133492-133769
472-664 AC124584.5 133850-134042
665-1205 AC124584.5 134184-134724
1206-1385 AC124713.5 184676-184855 c
FEATURES Location/Qualifiers
source 1..1385
/organism="Mus musculus"
/mol_type="mRNA"
/strain="C57BL/6"
/db_xref="taxon:10090"
/chromosome="8"
/map="8 53.04 cM"
gene 1..1385
/gene="Tradd"
/gene_synonym="9130005N23Rik"
/note="TNFRSF1A-associated via death domain"
/db_xref="GeneID:71609"
/db_xref="MGI:MGI:109200"
exon 1..34
/gene="Tradd"
/gene_synonym="9130005N23Rik"
/inference="alignment:Splign:2.1.0"
exon 35..193
/gene="Tradd"
/gene_synonym="9130005N23Rik"
/inference="alignment:Splign:2.1.0"
CDS 43..975
/gene="Tradd"
/gene_synonym="9130005N23Rik"
/note="TNF receptor 1 associated signal transducer;
TNFR1-associated DEATH domain protein"
/codon_start=1
/product="tumor necrosis factor receptor type 1-associated
DEATH domain protein"
/protein_id="NP_001028333.1"
/db_xref="CCDS:CCDS22594.1"
/db_xref="GeneID:71609"
/db_xref="MGI:MGI:109200"
/translation="
MAAGQNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSESGDSSDVLQILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRAGAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGAIQVASAGSKFPVSSPTEEKPLPAACQTFLFHGQLVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCRALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLLGQAEPDGGLA"
misc_feature 193..486
/gene="Tradd"
/gene_synonym="9130005N23Rik"
/note="TRADD, N-terminal domain; Region: TRADD_N;
pfam09034"
/db_xref="CDD:430379"
misc_feature 481..531
/gene="Tradd"
/gene_synonym="9130005N23Rik"
/note="propagated from UniProtKB/Swiss-Prot (Q3U0V2.1);
Region: Nuclear export signal.
/evidence=ECO:0000269|PubMed:22561347"
misc_feature 679..945
/gene="Tradd"
/gene_synonym="9130005N23Rik"
/note="Death Domain of Tumor Necrosis Factor Receptor
1-Associated Death Domain protein; Region: Death_TRADD;
cd08780"
/db_xref="CDD:260050"
misc_feature 700..903
/gene="Tradd"
/gene_synonym="9130005N23Rik"
/note="propagated from UniProtKB/Swiss-Prot (Q3U0V2.1);
Region: Interaction with KRT14 and KRT18.
/evidence=ECO:0000250|UniProtKB:Q15628"
misc_feature 727..768
/gene="Tradd"
/gene_synonym="9130005N23Rik"
/note="propagated from UniProtKB/Swiss-Prot (Q3U0V2.1);
Region: Nuclear localization signal.
/evidence=ECO:0000269|PubMed:22561347"
misc_feature 769..771
/gene="Tradd"
/gene_synonym="9130005N23Rik"
/note="(Microbial infection) N-beta-linked (GlcNAc)
arginine. /evidence=ECO:0000269|PubMed:30902834;
propagated from UniProtKB/Swiss-Prot (Q3U0V2.1);
glycosylation site"
exon 194..471
/gene="Tradd"
/gene_synonym="9130005N23Rik"
/inference="alignment:Splign:2.1.0"
exon 472..664
/gene="Tradd"
/gene_synonym="9130005N23Rik"
/inference="alignment:Splign:2.1.0"
exon 665..1385
/gene="Tradd"
/gene_synonym="9130005N23Rik"
/inference="alignment:Splign:2.1.0"
ORIGIN
gcgcagcagagccaggcgagtgtgcggcggccaggaggcaagatggcagccggtcagaatggccacgaggagtgggtgggcagtgcatacctgtttttggagtctgcggtagacaaggtgatcctgtctgaagcctacacggatcccaagaagaaggtggcaatatacaaggctctgcagactgcactgtcagagagtggggacagctctgacgtactgcagatactcaagatccactgcagcgaccctcagctcatcgtccagttgcggttctgcgggcgcgtgctgtgcggccgcttcctccaagcctaccgcgagggggcgctgcgcaccgcgctgcagaggtgcatggccccggcgcttgcccaggaagcgctgcggttgcagctggagttgcgtgcaggtgcggagcagctggacagttggctgactgatgaagagcgctgtttgaattacatcttagcccagaagcccgaccggctcagggacgaggaactcgcggagctggaggatgagctctgcaaactgacgtgtgactgcactggccagggtggagccatacaggtagcttctgcaggttcgaagttcccggtttcctctccgaccgaggagaaaccactgccggccgcctgccagacttttctgttccacgggcagctcgtagtgaaccggccactgactcttcaagaccagcagacgtttgcgcgctcggtgggtctcaagtggcgcagggtggggcgctcgctgcagcgtaactgtcgggcactgagagatcctgccctcgactcgctggcctacgagtatgagcgtgatgggctatacgagcaggccttccagctgctgcgccgtttcatgcaagccgagggccgccgtgccacactgcagcgcctggtggaggcgctggaggagaacgaactcactagtctagcagaggatctgttgggccaggcggagccggatggcggcctggcctaagtctagtactgtggggaagggcggccaaccagcagttcagtgtttgaaacccacgggtggctgttggggtatttttttaccgctgatgttgctactgctgaccactttccatctactggacttggagagcatacgcacgccccacctagctgagctgctggagtgcaactaactgcccctccccccgccccccaggagccaggcaagcagcgcaggggtaaatcactgatgatcatacaaaaagaggacttgctgcaaagaccctctaagtacccggaccttctgaaacctagctcaaggtgctacaaaaactgtcgggagcaggatgcacgattttccccgcccttggcatatactcatcgtgggaccgaagcaccttgtctgcagcgataataaaatgtaactctttt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]