LOCUS       NM_001024842             915 bp    mRNA    linear   ROD 03-APR-2024
DEFINITION  Mus musculus homeobox C11 (Hoxc11), mRNA.
ACCESSION   NM_001024842 XM_111600
VERSION     NM_001024842.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 915)
  AUTHORS   Kumar,S., Alam,S.S., Bareke,E., Beauchamp,M.C., Dong,Y., Chan,W.,
            Majewski,J. and Jerome-Majewska,L.A.
  TITLE     Sf3b4 regulates chromatin remodeler splicing and Hox expression
  JOURNAL   Differentiation 131, 59-73 (2023)
   PUBMED   37167859
REFERENCE   2  (bases 1 to 915)
  AUTHORS   Rux,D., Helbig,K., Koyama,E. and Pacifici,M.
  TITLE     Hox11 expression characterizes developing zeugopod synovial joints
            and is coupled to postnatal articular cartilage morphogenesis into
            functional zones in mice
  JOURNAL   Dev Biol 477, 49-63 (2021)
   PUBMED   34010606
REFERENCE   3  (bases 1 to 915)
  AUTHORS   Higashijima,Y., Nagai,N., Yamamoto,M., Kitazawa,T., Kawamura,Y.K.,
            Taguchi,A., Nakada,N., Nangaku,M., Furukawa,T., Aburatani,H.,
            Kurihara,H., Wada,Y. and Kanki,Y.
  TITLE     Lysine demethylase 7a regulates murine anterior-posterior
            development by modulating the transcription of Hox gene cluster
  JOURNAL   Commun Biol 3 (1), 725 (2020)
   PUBMED   33257809
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 915)
  AUTHORS   Sato,T., Kataoka,K., Ito,Y., Yokoyama,S., Inui,M., Mori,M.,
            Takahashi,S., Akita,K., Takada,S., Ueno-Kudoh,H. and Asahara,H.
  TITLE     Lin28a/let-7 pathway modulates the Hox code via Polycomb regulation
            during axial patterning in vertebrates
  JOURNAL   Elife 9, e53608 (2020)
   PUBMED   32479258
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 915)
  AUTHORS   Coughlan,E., Garside,V.C., Wong,S.F.L., Liang,H., Kraus,D.,
            Karmakar,K., Maheshwari,U., Rijli,F.M., Bourne,J. and McGlinn,E.
  TITLE     A Hox Code Defines Spinocerebellar Neuron Subtype Regionalization
  JOURNAL   Cell Rep 29 (8), 2408-2421 (2019)
   PUBMED   31747609
REFERENCE   6  (bases 1 to 915)
  AUTHORS   Peterson,R.L., Papenbrock,T., Davda,M.M. and Awgulewitsch,A.
  TITLE     The murine Hoxc cluster contains five neighboring AbdB-related Hox
            genes that show unique spatially coordinated expression in
            posterior embryonic subregions
  JOURNAL   Mech Dev 47 (3), 253-260 (1994)
   PUBMED   7848872
REFERENCE   7  (bases 1 to 915)
  AUTHORS   Bradshaw,M.S. and Ruddle,F.H.
  TITLE     Identification of the murine Hox-c12 and Hox-c13 homeoboxes on
            yeast artificial chromosomes
  JOURNAL   Genomics 22 (1), 234-236 (1994)
   PUBMED   7959778
REFERENCE   8  (bases 1 to 915)
  AUTHORS   Goto,J., Miyabayashi,T., Wakamatsu,Y., Takahashi,N. and
            Muramatsu,M.
  TITLE     Organization and expression of mouse Hox3 cluster genes
  JOURNAL   Mol Gen Genet 239 (1-2), 41-48 (1993)
   PUBMED   8099712
REFERENCE   9  (bases 1 to 915)
  AUTHORS   Scott,M.P.
  TITLE     Vertebrate homeobox gene nomenclature
  JOURNAL   Cell 71 (4), 551-553 (1992)
   PUBMED   1358459
REFERENCE   10 (bases 1 to 915)
  AUTHORS   Singh,G., Kaur,S., Stock,J.L., Jenkins,N.A., Gilbert,D.J.,
            Copeland,N.G. and Potter,S.S.
  TITLE     Identification of 10 murine homeobox genes
  JOURNAL   Proc Natl Acad Sci U S A 88 (23), 10706-10710 (1991)
   PUBMED   1683707
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AC160979.2.
            
            On Jun 15, 2005 this sequence version replaced XM_111600.3.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC139233.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849375
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-682               AC160979.2         207616-208297
            683-915             AC160979.2         209559-209791
FEATURES             Location/Qualifiers
     source          1..915
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10090"
                     /chromosome="15"
                     /map="15 58.02 cM"
     gene            1..915
                     /gene="Hoxc11"
                     /gene_synonym="Hox-3.7"
                     /note="homeobox C11"
                     /db_xref="GeneID:109663"
                     /db_xref="MGI:MGI:96193"
     CDS             1..915
                     /gene="Hoxc11"
                     /gene_synonym="Hox-3.7"
                     /note="homeobox protein Hox-3.7; homeo box C11"
                     /codon_start=1
                     /product="homeobox protein Hox-C11"
                     /protein_id="NP_001020013.1"
                     /db_xref="CCDS:CCDS27892.1"
                     /db_xref="GeneID:109663"
                     /db_xref="MGI:MGI:96193"
                     /translation="

MFNSVNLGNFCSPSRKERGADFGERGSCTSNLYLPSCTYYVPEFSTVSSFLPQAPSRQISYPYSAQVPPVREVSYGLEPSGKWHHRNSYSSCYAAADELMHRECLPPSTVTEILMKNEGSYGGHHHPSAPHAAPAGFYSSVNKNSVLPQAFDRFFDNAYCGGGDAPAEPPCSGKGEAKGEPEAPPASGLASRAEAGAEAEAEEENTNPSSSGSSHSATKEPAKGAAPNAPRTRKKRCPYSKFQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKLSRDRLQYFSGNPLL"

     misc_feature    124..483
                     /gene="Hoxc11"
                     /gene_synonym="Hox-3.7"
                     /note="Protein of unknown function (DUF3528); Region:
                     DUF3528; pfam12045"
                     /db_xref="CDD:432284"
     misc_feature    499..711
                     /gene="Hoxc11"
                     /gene_synonym="Hox-3.7"
                     /note="propagated from UniProtKB/Swiss-Prot (P31313.3);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    697..867
                     /gene="Hoxc11"
                     /gene_synonym="Hox-3.7"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            1..682
                     /gene="Hoxc11"
                     /gene_synonym="Hox-3.7"
                     /inference="alignment:Splign:2.1.0"
     exon            683..915
                     /gene="Hoxc11"
                     /gene_synonym="Hox-3.7"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atgtttaactcggtcaacctgggcaacttctgctcgccttcgcgcaaggagaggggcgctgacttcggcgaacgagggagctgcacctccaacctctatctgcccagttgcacttactacgtgcctgagttctccaccgtctcttccttcctaccccaggctccctctcgtcagatttcttatccctactcagcccaagtgcccccggtccgggaggtctcctacggcctggaaccgtccgggaagtggcaccatcggaacagctactcgtcttgttatgcggcggccgacgagcttatgcaccgggagtgcctgcctccttccacagtcactgagatcctcatgaaaaatgaaggctcctacggcggccaccaccaccccagcgccccgcacgcggcccccgccggcttctactcctcagtcaacaagaacagcgtcttgccccaagctttcgaccgcttcttcgacaacgcctactgcggtgggggagatgcgcccgccgagcccccctgctccggcaagggcgaggccaagggggagcctgaggcgccccccgcctcgggacttgcgtcccgggcagaggccggtgctgaggccgaggccgaggaggagaacacgaatcccagctcgtccggttcttcccactcggcgaccaaggagccggccaagggagccgcccccaacgccccccgcacccgcaagaagcgctgcccttattcgaaattccagatccgggaactggagcgagagtttttcttcaacgtgtacatcaacaaagagaagcggctgcagctgtcccggatgctgaacctgacagaccgacaagtgaaaatttggtttcagaacaggagaatgaaagaaaaaaaactgagcagagaccggctgcagtatttttcaggaaatccactgctgtaa

//