GGRNA ver.2 Help | Advanced search | English    旧バージョン

2025-04-20 14:34:55, GGRNA : RefSeq release 229 (Mar, 2025)

Summary:

Results:

検索語に色がつきます重なると色が濃く表示されます。

PREDICTED: Rattus norvegicus glutathione S-transferase alpha 1 (Gsta1), transcript variant X1, mRNA. (2909 bp)
mRNA" /strain="BN/NHsdMcwi" /bio_material="RGD 61498" /db_xref="taxon:10116" /chromosome="9" /sex="male" /tissue_type="kidney, spleen, liver" /geo_loc_name="USA: Wisconsin, Milwaukee" /lat_lon="43.05 N 88.04 W" /collected_by="Rebecca Schilling, Melinda Dwinell" gene 1..2909 /gene="Gsta1" /gene_synonym="GST 2-2; GST A3-3; GST AA; GST Yc1; Gsta3; Gsta5; Yc1" /note="glutathione S-transferase alpha 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 758 long SRA reads, 6 Proteins" /db_xref="GeneID:24421" /db_xref="...
Synonym: GST 2-2; GST A3-3; GST AA; GST Yc1; Gsta3; Gsta5; Yc1
XM_063266628.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Drosophila melanogaster glutathione S transferase D1, transcript variant A (GstD1), mRNA. (825 bp)
melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="3R" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..825 /gene="GstD1" /locus_tag="Dmel_CG10045" /gene_synonym="CG10045; D1; dGstD1; dGSTT2; Dmel\CG10045; DmGST-1; DmGst1; DmGST1; dmGSTD1; DmGSTD1; DmGSTD1-1; G-S-T; gst; Gst; GST; GST-1; gst-D; Gst-D1; GST-D1; gst-D1-1; Gst1; GST1; Gst1-1; GSt1-1; GST1-1; Gst1.1; GSTase; gstD; GstD; gstd1; gstD1; GSTD1; T5" /note="Glutathione S transferase D1" /map="87B8-87B8" /db_xref="FLYBASE:FBgn0001149" /db_xref="GeneID:41503"...
Synonym: CG10045; D1; dGstD1; dGSTT2; Dmel\CG10045; DmGST-1; DmGst1; DmGST1; dmGSTD1; DmGSTD1; DmGSTD1-1; G-S-T; gst; Gst; GST; GST-1; gst-D; Gst-D1; GST-D1; gst-D1-1; Gst1; GST1; Gst1-1; GSt1-1; GST1-1; Gst1.1; GSTase; gstD; GstD; gstd1; gstD1; GSTD1; T5
NM_079602.5 - Drosophila melanogaster (fruit fly) - NCBI - UCSC - FlyBase
Drosophila melanogaster glutathione S transferase D1, transcript variant B (GstD1), mRNA. (843 bp)
melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="3R" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..843 /gene="GstD1" /locus_tag="Dmel_CG10045" /gene_synonym="CG10045; D1; dGstD1; dGSTT2; Dmel\CG10045; DmGST-1; DmGst1; DmGST1; dmGSTD1; DmGSTD1; DmGSTD1-1; G-S-T; gst; Gst; GST; GST-1; gst-D; Gst-D1; GST-D1; gst-D1-1; Gst1; GST1; Gst1-1; GSt1-1; GST1-1; Gst1.1; GSTase; gstD; GstD; gstd1; gstD1; GSTD1; T5" /note="Glutathione S transferase D1" /map="87B8-87B8" /db_xref="FLYBASE:FBgn0001149" /db_xref="GeneID:41503"...
Synonym: CG10045; D1; dGstD1; dGSTT2; Dmel\CG10045; DmGST-1; DmGst1; DmGST1; dmGSTD1; DmGSTD1; DmGSTD1-1; G-S-T; gst; Gst; GST; GST-1; gst-D; Gst-D1; GST-D1; gst-D1-1; Gst1; GST1; Gst1-1; GSt1-1; GST1-1; Gst1.1; GSTase; gstD; GstD; gstd1; gstD1; GSTD1; T5
NM_001038953.2 - Drosophila melanogaster (fruit fly) - NCBI - UCSC - FlyBase
PREDICTED: Rattus norvegicus glutathione S-transferase pi 1 (Gstp1), transcript variant X1, mRNA. (1155 bp)
mRNA" /strain="BN/NHsdMcwi" /bio_material="RGD 61498" /db_xref="taxon:10116" /chromosome="1" /sex="male" /tissue_type="kidney, spleen, liver" /geo_loc_name="USA: Wisconsin, Milwaukee" /lat_lon="43.05 N 88.04 W" /collected_by="Rebecca Schilling, Melinda Dwinell" gene 1..1155 /gene="Gstp1" /gene_synonym="GST-P; Gst3; Gstp; Gstp2" /note="glutathione S-transferase pi 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 305 ESTs, 65087 long SRA reads, 25 Proteins" /db_xref="GeneID:24426" /db_xref="RGD:2758" CDS...
Synonym: GST-P; Gst3; Gstp; Gstp2
XM_063280727.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus glutathione S-transferase mu 3 (Gstm3), transcript variant X1, misc_RNA. (705 bp)
LOCUS XR_005500356 705 bp RNA linear ROD 22-FEB-2024 DEFINITION PREDICTED: Rattus norvegicus glutathione S-transferase mu 3 (Gstm3), transcript variant X1, misc_RNA. ACCESSION XR_005500356 VERSION XR_005500356.1 DBLINK BioProject: PRJNA1074393 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is...
Synonym: Gstm3l; Gstm3l1; Gstm4; GstYb4
XR_005500356.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Drosophila melanogaster glutathione S transferase E1 (GstE1), mRNA. (831 bp)
FEATURES Location/Qualifiers source 1..831 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="2R" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..831 /gene="GstE1" /locus_tag="Dmel_CG5164" /gene_synonym="CG5164; CT16545; Dmel\CG5164; DmGST-3; DmGSTE1; DmGSTE1-1; gst-3; Gst-3; GST-3; GST-E1; Gst-theta 55F; Gst3; GST3; Gst55F; gste1; gstE1; GSTE1" /note="Glutathione S transferase E1" /map="55C6-55C6" /db_xref="FLYBASE:FBgn0034335" /db_xref="GeneID:37106" CDS 40..714 /gene="GstE1" /locus_tag="Dmel...
Synonym: CG5164; CT16545; Dmel\CG5164; DmGST-3; DmGSTE1; DmGSTE1-1; gst-3; Gst-3; GST-3; GST-E1; Gst-theta 55F; Gst3; GST3; Gst55F; gste1; gstE1; GSTE1
NM_137479.3 - Drosophila melanogaster (fruit fly) - NCBI - UCSC - FlyBase
Drosophila melanogaster glutathione S transferase D2 (GstD2), mRNA. (734 bp)
Data-END## FEATURES Location/Qualifiers source 1..734 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="3R" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..734 /gene="GstD2" /locus_tag="Dmel_CG4181" /gene_synonym="CG4181; Dmel\CG4181; DmGST21; DmGSTD2; gst; Gst; GST; Gst D2; GST D2; gst D21; GST-D2; gstd2; gstD2; GSTd2; GSTD2; gstd21; gstD21; Gstd21; GstD21" /note="Glutathione S transferase D2" /map="87B8-87B8" /db_xref="FLYBASE:FBgn0010038" /db_xref="GeneID:48335" CDS 28..675 /gene="GstD2" /...
Synonym: CG4181; Dmel\CG4181; DmGST21; DmGSTD2; gst; Gst; GST; Gst D2; GST D2; gst D21; GST-D2; gstd2; gstD2; GSTd2; GSTD2; gstd21; gstD21; Gstd21; GstD21
NM_080173.2 - Drosophila melanogaster (fruit fly) - NCBI - UCSC - FlyBase
PREDICTED: Rattus norvegicus glutathione S-transferase mu 3 (Gstm3), transcript variant X2, mRNA. (853 bp)
db_xref="RGD:620381" CDS 96..428 /gene="Gstm3" /gene_synonym="Gstm3l; Gstm3l1; Gstm4; GstYb4" /codon_start=1 /product="glutathione S-transferase Mu 3 isoform X1" /protein_id="XP_038958931.1" /db_xref="GeneID:57298" /db_xref="RGD:620381" /translation="MAMILGYWNVRGEKQKPEFLKSIPEKMKIYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPECLDAFPNLKDFLARFEGLKKISAYMKSSSFLPRPVFTKIAQWGTD" misc_feature <132..407 /gene="Gstm3" /gene_synonym="Gstm3l; Gstm3l1; Gstm4; GstYb4" /note="C-terminal, alpha helical domain of the Glutathione S-transferase family; Region: GST_C_family; cl02776" /db_xref="CDD:470672" polyA_site 853 /...
Synonym: Gstm3l; Gstm3l1; Gstm4; GstYb4
XM_039103003.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus glutathione S-transferase, mu 4 (Gstm4), transcript variant X4, mRNA. (705 bp)
SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/01/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..705 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6J" /db_xref="taxon:10090" /chromosome="3" gene 1..705 /gene="Gstm4" /gene_synonym="1110004G14Rik; Gstb-4; Gstb4; GSTM4-4; GSTM7-7" /note="glutathione S-transferase, mu 4; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 ESTs, 14 long SRA reads, 1 Protein, and 95% coverage of the annotated genomic feature by...
Synonym: 1110004G14Rik; Gstb-4; Gstb4; GSTM4-4; GSTM7-7
XM_017319462.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus microsomal glutathione S-transferase 2 (Mgst2), transcript variant X3, mRNA. (579 bp)
tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/01/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..579 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6J" /db_xref="taxon:10090" /chromosome="3" gene 1..579 /gene="Mgst2" /gene_synonym="GST2; MGST-II" /note="microsomal glutathione S-transferase 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 31 ESTs, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 8...
Synonym: GST2; MGST-II
XM_006501248.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus microsomal glutathione S-transferase 2 (Mgst2), transcript variant X1, mRNA. (929 bp)
tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/01/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..929 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6J" /db_xref="taxon:10090" /chromosome="3" gene 1..929 /gene="Mgst2" /gene_synonym="GST2; MGST-II" /note="microsomal glutathione S-transferase 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 9 samples with...
Synonym: GST2; MGST-II
XM_011240056.4 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus microsomal glutathione S-transferase 2 (Mgst2), transcript variant X5, mRNA. (648 bp)
tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/01/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..648 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6J" /db_xref="taxon:10090" /chromosome="3" gene 1..648 /gene="Mgst2" /gene_synonym="GST2; MGST-II" /note="microsomal glutathione S-transferase 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 30 ESTs, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 10...
Synonym: GST2; MGST-II
XM_030252528.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Mus musculus microsomal glutathione S-transferase 2 (Mgst2), transcript variant X4, mRNA. (727 bp)
tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/01/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..727 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6J" /db_xref="taxon:10090" /chromosome="3" gene 1..727 /gene="Mgst2" /gene_synonym="GST2; MGST-II" /note="microsomal glutathione S-transferase 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 30 ESTs, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14...
Synonym: GST2; MGST-II
XM_011240057.4 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Bombyx mori glutathione S-transferase omega 2 (GSTo2), transcript variant X2, mRNA. (2245 bp)
Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 01/25/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2245 /organism="Bombyx mori" /mol_type="mRNA" /db_xref="taxon:7091" /chromosome="11" gene 1..2245 /gene="GSTo2" /gene_synonym="GST6; Gsto" /note="glutathione S-transferase omega 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 long SRA reads, 26 Proteins" /db_xref="GeneID:692941" CDS 1147..1929 /gene="GSTo2" /gene_synonym="GST6; Gsto" /...
Synonym: GST6; Gsto
XM_062670843.1 - Bombyx mori (domestic silkworm) - NCBI
PREDICTED: Mus musculus microsomal glutathione S-transferase 2 (Mgst2), transcript variant X2, mRNA. (1301 bp)
tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/01/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1301 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6J" /db_xref="taxon:10090" /chromosome="3" gene 1..1301 /gene="Mgst2" /gene_synonym="GST2; MGST-II" /note="microsomal glutathione S-transferase 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 29 ESTs, 1 long SRA read, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments...
Synonym: GST2; MGST-II
XM_030252527.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Bombyx mori glutathione S-transferase omega 2 (GSTo2), transcript variant X3, mRNA. (1958 bp)
Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 01/25/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1958 /organism="Bombyx mori" /mol_type="mRNA" /db_xref="taxon:7091" /chromosome="11" gene 1..1958 /gene="GSTo2" /gene_synonym="GST6; Gsto" /note="glutathione S-transferase omega 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 2 ESTs, 819 long SRA reads, 38 Proteins" /db_xref="GeneID:692941" CDS 1147..1917 /gene="GSTo2" /gene_synonym...
Synonym: GST6; Gsto
XM_062670844.1 - Bombyx mori (domestic silkworm) - NCBI
PREDICTED: Bombyx mori glutathione S-transferase omega 2 (GSTo2), transcript variant X1, mRNA. (2322 bp)
Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 01/25/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2322 /organism="Bombyx mori" /mol_type="mRNA" /db_xref="taxon:7091" /chromosome="11" gene 1..2322 /gene="GSTo2" /gene_synonym="GST6; Gsto" /note="glutathione S-transferase omega 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 21 ESTs, 326 long SRA reads, 28 Proteins" /db_xref="GeneID:692941" CDS 1104..2006 /gene="GSTo2" /gene_synonym="GST6;...
Synonym: GST6; Gsto
XM_062670842.1 - Bombyx mori (domestic silkworm) - NCBI
PREDICTED: Rattus norvegicus glutathione S-transferase kappa 1 (Gstk1), transcript variant X1, mRNA. (851 bp)
type="mRNA" /strain="BN/NHsdMcwi" /bio_material="RGD 61498" /db_xref="taxon:10116" /chromosome="4" /sex="male" /tissue_type="kidney, spleen, liver" /geo_loc_name="USA: Wisconsin, Milwaukee" /lat_lon="43.05 N 88.04 W" /collected_by="Rebecca Schilling, Melinda Dwinell" gene 1..851 /gene="Gstk1" /gene_synonym="GST13-13; GSTkappa" /note="glutathione S-transferase kappa 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 ESTs, 59 long SRA reads, 1 Protein" /db_xref="GeneID:297029" /db_xref="RGD:735188" CDS 117..668 /gene...
Synonym: GST13-13; GSTkappa
XM_063285766.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Drosophila melanogaster glutathione S transferase D6 (GstD6), mRNA. (780 bp)
END## FEATURES Location/Qualifiers source 1..780 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="3R" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..780 /gene="GstD6" /locus_tag="Dmel_CG4423" /gene_synonym="CG4423; Dmel\CG4423; DmGST25; DmGstd6; DmGSTD6; gst; Gst; GST; Gst D6; Gst-D6; gstD25; GstD25; gstd6; GSTD6" /note="Glutathione S transferase D6" /map="87B8-87B8" /db_xref="FLYBASE:FBgn0010042" /db_xref="GeneID:48339" CDS 45..692 /gene="GstD6" /locus_tag="Dmel_CG4423" /gene_synonym="...
Synonym: CG4423; Dmel\CG4423; DmGST25; DmGstd6; DmGSTD6; gst; Gst; GST; Gst D6; Gst-D6; gstD25; GstD25; gstd6; GSTD6
NM_080176.3 - Drosophila melanogaster (fruit fly) - NCBI - UCSC - FlyBase
Drosophila melanogaster glutathione S transferase D5 (GstD5), mRNA. (840 bp)
END## FEATURES Location/Qualifiers source 1..840 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="3R" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..840 /gene="GstD5" /locus_tag="Dmel_CG12242" /gene_synonym="CG12242; D5; dGSTT4; Dmel\CG12242; DmGST24; DmGSTD5; gst; Gst; GST; Gst D5; gstD24; GstD24; gstd5; gstD5; GSTd5; GSTD5" /note="Glutathione S transferase D5" /map="87B8-87B8" /db_xref="FLYBASE:FBgn0010041" /db_xref="GeneID:48338" CDS 32..682 /gene="GstD5" /locus_tag="Dmel_CG12242" /gene_...
Synonym: CG12242; D5; dGSTT4; Dmel\CG12242; DmGST24; DmGSTD5; gst; Gst; GST; Gst D5; gstD24; GstD24; gstd5; gstD5; GSTd5; GSTD5
NM_080175.3 - Drosophila melanogaster (fruit fly) - NCBI - UCSC - FlyBase
PREDICTED: Gallus gallus glutathione S-transferase alpha 4 (GSTA4), transcript variant X4, mRNA. (901 bp)
LOCUS XM_046913019 901 bp mRNA linear VRT 01-MAR-2022 DEFINITION PREDICTED: Gallus gallus glutathione S-transferase alpha 4 (GSTA4), transcript variant X4, mRNA. ACCESSION XM_046913019 VERSION XM_046913019.1 DBLINK BioProject: PRJNA698614 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. COMMENT MODEL REFSEQ: This record is predicted by automated...
Synonym: GSTA3; GSTA4L
XM_046913019.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus glutathione S-transferase alpha 4 (GSTA4), transcript variant X4, mRNA. (901 bp)
LOCUS XM_046938434 901 bp mRNA linear VRT 01-MAR-2022 DEFINITION PREDICTED: Gallus gallus glutathione S-transferase alpha 4 (GSTA4), transcript variant X4, mRNA. ACCESSION XM_046938434 VERSION XM_046938434.1 DBLINK BioProject: PRJNA698609 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. COMMENT MODEL REFSEQ: This record is predicted by automated...
Synonym: GSTA3; GSTA4L
XM_046938434.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Homo sapiens microsomal glutathione S-transferase 1 (MGST1), transcript variant X5, mRNA. (651 bp)
LOCUS XM_054372066 651 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens microsomal glutathione S-transferase 1 (MGST1), transcript variant X5, mRNA. ACCESSION XM_054372066 VERSION XM_054372066.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GST12; MGST; MGST-I; PMAN
XM_054372066.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens microsomal glutathione S-transferase 1 (MGST1), transcript variant X2, mRNA. (7373 bp)
LOCUS XM_054372065 7373 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens microsomal glutathione S-transferase 1 (MGST1), transcript variant X2, mRNA. ACCESSION XM_054372065 VERSION XM_054372065.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GST12; MGST; MGST-I; PMAN
XM_054372065.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Gallus gallus glutathione S-transferase alpha 4 (GSTA4), transcript variant X1, mRNA. (917 bp)
LOCUS XM_046913016 917 bp mRNA linear VRT 01-MAR-2022 DEFINITION PREDICTED: Gallus gallus glutathione S-transferase alpha 4 (GSTA4), transcript variant X1, mRNA. ACCESSION XM_046913016 VERSION XM_046913016.1 DBLINK BioProject: PRJNA698614 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. COMMENT MODEL REFSEQ: This record is predicted by automated...
Synonym: GSTA3; GSTA4L
XM_046913016.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus glutathione S-transferase alpha 4 (GSTA4), transcript variant X2, mRNA. (931 bp)
LOCUS XM_046913017 931 bp mRNA linear VRT 01-MAR-2022 DEFINITION PREDICTED: Gallus gallus glutathione S-transferase alpha 4 (GSTA4), transcript variant X2, mRNA. ACCESSION XM_046913017 VERSION XM_046913017.1 DBLINK BioProject: PRJNA698614 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. COMMENT MODEL REFSEQ: This record is predicted by automated...
Synonym: GSTA3; GSTA4L
XM_046913017.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Homo sapiens microsomal glutathione S-transferase 1 (MGST1), transcript variant X6, mRNA. (5242 bp)
LOCUS XM_054372067 5242 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens microsomal glutathione S-transferase 1 (MGST1), transcript variant X6, mRNA. ACCESSION XM_054372067 VERSION XM_054372067.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GST12; MGST; MGST-I; PMAN
XM_054372067.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens microsomal glutathione S-transferase 1 (MGST1), transcript variant X1, mRNA. (7545 bp)
LOCUS XM_054372064 7545 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens microsomal glutathione S-transferase 1 (MGST1), transcript variant X1, mRNA. ACCESSION XM_054372064 VERSION XM_054372064.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GST12; MGST; MGST-I; PMAN
XM_054372064.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Gallus gallus glutathione S-transferase alpha 4 (GSTA4), transcript variant X1, mRNA. (917 bp)
LOCUS XM_015284816 917 bp mRNA linear VRT 01-MAR-2022 DEFINITION PREDICTED: Gallus gallus glutathione S-transferase alpha 4 (GSTA4), transcript variant X1, mRNA. ACCESSION XM_015284816 VERSION XM_015284816.4 DBLINK BioProject: PRJNA698609 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. COMMENT MODEL REFSEQ: This record is predicted by automated...
Synonym: GSTA3; GSTA4L
XM_015284816.4 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus glutathione S-transferase alpha 4 (GSTA4), transcript variant X2, mRNA. (931 bp)
LOCUS XM_040696766 931 bp mRNA linear VRT 01-MAR-2022 DEFINITION PREDICTED: Gallus gallus glutathione S-transferase alpha 4 (GSTA4), transcript variant X2, mRNA. ACCESSION XM_040696766 VERSION XM_040696766.2 DBLINK BioProject: PRJNA698609 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. COMMENT MODEL REFSEQ: This record is predicted by automated...
Synonym: GSTA3; GSTA4L
XM_040696766.2 - Gallus gallus (chicken) - NCBI - UCSC
Drosophila melanogaster glutathione S transferase D8 (GstD8), mRNA. (808 bp)
Data-END## FEATURES Location/Qualifiers source 1..808 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="3R" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..808 /gene="GstD8" /locus_tag="Dmel_CG4421" /gene_synonym="CG4421; Dmel\CG4421; DmGST27; DmGSTD8; gst; Gst; GST; GST D27; gstD27; GstD27; gstd8; gstD8; GSTD8" /note="Glutathione S transferase D8" /map="87B8-87B8" /db_xref="FLYBASE:FBgn0010044" /db_xref="GeneID:48341" CDS 29..667 /gene="GstD8" /locus_tag="Dmel_CG4421" /gene_synonym="CG4421;...
Synonym: CG4421; Dmel\CG4421; DmGST27; DmGSTD8; gst; Gst; GST; GST D27; gstD27; GstD27; gstd8; gstD8; GSTD8
NM_080177.4 - Drosophila melanogaster (fruit fly) - NCBI - UCSC - FlyBase
Drosophila melanogaster glutathione S transferase D4 (GstD4), mRNA. (725 bp)
END## FEATURES Location/Qualifiers source 1..725 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="3R" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..725 /gene="GstD4" /locus_tag="Dmel_CG11512" /gene_synonym="CG11512; Dmel\CG11512; DmGST23; DmGstd4; DmGSTD4; gst; Gst; GST; gstD23; GstD23; gstd4; gstD4; GSTD4" /note="Glutathione S transferase D4" /map="87B8-87B8" /db_xref="FLYBASE:FBgn0010040" /db_xref="GeneID:48337" CDS 54..701 /gene="GstD4" /locus_tag="Dmel_CG11512" /gene_synonym="CG11512;...
Synonym: CG11512; Dmel\CG11512; DmGST23; DmGstd4; DmGSTD4; gst; Gst; GST; gstD23; GstD23; gstd4; gstD4; GSTD4
NM_080174.4 - Drosophila melanogaster (fruit fly) - NCBI - UCSC - FlyBase
PREDICTED: Mus musculus glutathione S-transferase, alpha 2 (Yc2) (Gsta2), transcript variant X1, mRNA. (1015 bp)
db_xref="MGI:MGI:95863" CDS 238..906 /gene="Gsta2" /gene_synonym="Gst2-2; Gstc-2; Gstc2" /codon_start=1 /product="glutathione S-transferase A2 isoform X1" /protein_id="XP_006510877.1" /db_xref="GeneID:14858" /db_xref="MGI:MGI:95863" /translation="MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDVHLLELLLYVEELDASLLTPFPLLKAFKSRISSLPNVKKFLHPGSQRKPPLDAKQIEEARKVFKF" misc_feature 247..483 /gene="Gsta2" /gene_synonym="Gst2-2; Gstc-2; Gstc2" /note="GST_N family, Class Alpha subfamily; GSTs are...
Synonym: Gst2-2; Gstc-2; Gstc2
XM_006510814.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Gallus gallus glutathione S-transferase alpha 4 (GSTA4), transcript variant X3, mRNA. (3195 bp)
LOCUS XM_046913018 3195 bp mRNA linear VRT 01-MAR-2022 DEFINITION PREDICTED: Gallus gallus glutathione S-transferase alpha 4 (GSTA4), transcript variant X3, mRNA. ACCESSION XM_046913018 VERSION XM_046913018.1 DBLINK BioProject: PRJNA698614 KEYWORDS RefSeq; includes ab initio. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. COMMENT MODEL REFSEQ: This record is predicted...
Synonym: GSTA3; GSTA4L
XM_046913018.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Gallus gallus glutathione S-transferase alpha 4 (GSTA4), transcript variant X3, mRNA. (3200 bp)
LOCUS XM_040696767 3200 bp mRNA linear VRT 01-MAR-2022 DEFINITION PREDICTED: Gallus gallus glutathione S-transferase alpha 4 (GSTA4), transcript variant X3, mRNA. ACCESSION XM_040696767 VERSION XM_040696767.2 DBLINK BioProject: PRJNA698609 KEYWORDS RefSeq; includes ab initio. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. COMMENT MODEL REFSEQ: This record is predicted...
Synonym: GSTA3; GSTA4L
XM_040696767.2 - Gallus gallus (chicken) - NCBI - UCSC
Drosophila melanogaster glutathione S transferase D3 (GstD3), mRNA. (746 bp)
FEATURES Location/Qualifiers source 1..746 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="3R" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..746 /gene="GstD3" /locus_tag="Dmel_CG4381" /gene_synonym="BcDNA:LP11313; CG4381; D3; Dmel\CG4381; DmGST22; DmGSTD3; gst; Gst; GST-D3; gstD22; GstD22; gstd3; gstD3; GSTD3" /note="Glutathione S transferase D3" /map="87B8-87B8" /db_xref="FLYBASE:FBgn0010039" /db_xref="GeneID:48336" CDS 63..662 /gene="GstD3" /locus_tag="Dmel_CG4381" /gene_synonym="BcDNA:...
Synonym: BcDNA:LP11313; CG4381; D3; Dmel\CG4381; DmGST22; DmGSTD3; gst; Gst; GST-D3; gstD22; GstD22; gstd3; gstD3; GSTD3
NM_176479.2 - Drosophila melanogaster (fruit fly) - NCBI - UCSC - FlyBase
Drosophila melanogaster glutathione S transferase D7 (GstD7), mRNA. (756 bp)
END## FEATURES Location/Qualifiers source 1..756 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" /chromosome="3R" /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2] bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]" gene 1..756 /gene="GstD7" /locus_tag="Dmel_CG4371" /gene_synonym="CG4371; Dmel\CG4371; DmGST26; DmGstd7; DmGSTD7; gst; Gst; gstD26; GstD26; gstd7; gstD7; GSTD7" /note="Glutathione S transferase D7" /map="87B8-87B8" /db_xref="FLYBASE:FBgn0010043" /db_xref="GeneID:48340" CDS 47..721 /gene="GstD7" /locus_tag="Dmel_CG4371" /gene_synonym="CG4371; Dmel\...
Synonym: CG4371; Dmel\CG4371; DmGST26; DmGstd7; DmGSTD7; gst; Gst; gstD26; GstD26; gstd7; gstD7; GSTD7
NM_080375.3 - Drosophila melanogaster (fruit fly) - NCBI - UCSC - FlyBase
PREDICTED: Homo sapiens microsomal glutathione S-transferase 2 (MGST2), transcript variant X3, mRNA. (1286 bp)
LOCUS XM_054350051 1286 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens microsomal glutathione S-transferase 2 (MGST2), transcript variant X3, mRNA. ACCESSION XM_054350051 VERSION XM_054350051.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GST2; MGST-II
XM_054350051.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens microsomal glutathione S-transferase 2 (MGST2), transcript variant X1, mRNA. (1508 bp)
LOCUS XM_054350049 1508 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens microsomal glutathione S-transferase 2 (MGST2), transcript variant X1, mRNA. ACCESSION XM_054350049 VERSION XM_054350049.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GST2; MGST-II
XM_054350049.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens microsomal glutathione S-transferase 3 (MGST3), transcript variant X1, mRNA. (1202 bp)
LOCUS XM_054336666 1202 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens microsomal glutathione S-transferase 3 (MGST3), transcript variant X1, mRNA. ACCESSION XM_054336666 VERSION XM_054336666.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GST-3; GST-III
XM_054336666.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens microsomal glutathione S-transferase 3 (MGST3), transcript variant X2, mRNA. (1999 bp)
LOCUS XM_054336667 1999 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens microsomal glutathione S-transferase 3 (MGST3), transcript variant X2, mRNA. ACCESSION XM_054336667 VERSION XM_054336667.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GST-3; GST-III
XM_054336667.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens microsomal glutathione S-transferase 2 (MGST2), transcript variant X2, mRNA. (6465 bp)
LOCUS XM_054350050 6465 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens microsomal glutathione S-transferase 2 (MGST2), transcript variant X2, mRNA. ACCESSION XM_054350050 VERSION XM_054350050.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GST2; MGST-II
XM_054350050.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus glutathione S-transferase mu 4 (Gstm4), transcript variant X7, mRNA. (614 bp)
type="mRNA" /strain="BN/NHsdMcwi" /bio_material="RGD 61498" /db_xref="taxon:10116" /chromosome="2" /sex="male" /tissue_type="kidney, spleen, liver" /geo_loc_name="USA: Wisconsin, Milwaukee" /lat_lon="43.05 N 88.04 W" /collected_by="Rebecca Schilling, Melinda Dwinell" gene 1..614 /gene="Gstm4" /gene_synonym="GSTM4-4" /note="glutathione S-transferase mu 4; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:499689" /db_xref="RGD:1565825" CDS 152..493 /gene="Gstm4" /gene_synonym="GSTM4-4" /codon_start=1 /product="glutathione S-transferase Mu 4...
Synonym: GSTM4-4
XM_063282404.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens glutathione S-transferase alpha 1 (GSTA1), transcript variant X1, mRNA. (1416 bp)
LOCUS XM_054355256 1416 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens glutathione S-transferase alpha 1 (GSTA1), transcript variant X1, mRNA. ACCESSION XM_054355256 VERSION XM_054355256.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GST-epsilon; GST2; GSTA1-1; GTH1
XM_054355256.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Bombyx mori glutathione S-transferase epsilon 6 (GSTe6), transcript variant X5, mRNA. (1559 bp)
LOCUS XM_062674541 1559 bp mRNA linear INV 05-FEB-2024 DEFINITION PREDICTED: Bombyx mori glutathione S-transferase epsilon 6 (GSTe6), transcript variant X5, mRNA. ACCESSION XM_062674541 VERSION XM_062674541.1 DBLINK BioProject: PRJNA1068671 KEYWORDS RefSeq. SOURCE Bombyx mori (domestic silkworm) ORGANISM Bombyx mori Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea; Bombycidae; Bombycinae; Bombyx. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived...
Synonym: GST12
XM_062674541.1 - Bombyx mori (domestic silkworm) - NCBI
PREDICTED: Bombyx mori glutathione S-transferase epsilon 2 (GSTe2), transcript variant X3, mRNA. (1035 bp)
LOCUS XM_062676244 1035 bp mRNA linear INV 05-FEB-2024 DEFINITION PREDICTED: Bombyx mori glutathione S-transferase epsilon 2 (GSTe2), transcript variant X3, mRNA. ACCESSION XM_062676244 VERSION XM_062676244.1 DBLINK BioProject: PRJNA1068671 KEYWORDS RefSeq. SOURCE Bombyx mori (domestic silkworm) ORGANISM Bombyx mori Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea; Bombycidae; Bombycinae; Bombyx. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived...
Synonym: GST5
XM_062676244.1 - Bombyx mori (domestic silkworm) - NCBI
PREDICTED: Bombyx mori glutathione S-transferase epsilon 2 (GSTe2), transcript variant X2, mRNA. (1058 bp)
LOCUS XM_062676243 1058 bp mRNA linear INV 05-FEB-2024 DEFINITION PREDICTED: Bombyx mori glutathione S-transferase epsilon 2 (GSTe2), transcript variant X2, mRNA. ACCESSION XM_062676243 VERSION XM_062676243.1 DBLINK BioProject: PRJNA1068671 KEYWORDS RefSeq. SOURCE Bombyx mori (domestic silkworm) ORGANISM Bombyx mori Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea; Bombycidae; Bombycinae; Bombyx. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived...
Synonym: GST5
XM_062676243.1 - Bombyx mori (domestic silkworm) - NCBI
PREDICTED: Bombyx mori glutathione S-transferase epsilon 2 (GSTe2), transcript variant X1, mRNA. (1171 bp)
LOCUS XM_062676242 1171 bp mRNA linear INV 05-FEB-2024 DEFINITION PREDICTED: Bombyx mori glutathione S-transferase epsilon 2 (GSTe2), transcript variant X1, mRNA. ACCESSION XM_062676242 VERSION XM_062676242.1 DBLINK BioProject: PRJNA1068671 KEYWORDS RefSeq. SOURCE Bombyx mori (domestic silkworm) ORGANISM Bombyx mori Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea; Bombycidae; Bombycinae; Bombyx. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived...
Synonym: GST5
XM_062676242.1 - Bombyx mori (domestic silkworm) - NCBI
PREDICTED: Bombyx mori glutathione S-transferase epsilon 6 (GSTe6), transcript variant X3, mRNA. (1578 bp)
LOCUS XM_062674540 1578 bp mRNA linear INV 05-FEB-2024 DEFINITION PREDICTED: Bombyx mori glutathione S-transferase epsilon 6 (GSTe6), transcript variant X3, mRNA. ACCESSION XM_062674540 VERSION XM_062674540.1 DBLINK BioProject: PRJNA1068671 KEYWORDS RefSeq. SOURCE Bombyx mori (domestic silkworm) ORGANISM Bombyx mori Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea; Bombycidae; Bombycinae; Bombyx. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived...
Synonym: GST12
XM_062674540.1 - Bombyx mori (domestic silkworm) - NCBI
Zea mays Glutathione transferase III(b) (LOC541990), mRNA. (1227 bp)
gene="LOC541990" /gene_synonym="GRMZM2G146246; GST3; gst3a; gst3b; gst4" /note="Glutathione transferase III(b)" /db_xref="GeneID:541990" exon 1..284 /gene="LOC541990" /gene_synonym="GRMZM2G146246; GST3; gst3a; gst3b; gst4" /inference="alignment:Splign:2.1.0" misc_feature 27..29 /gene="LOC541990" /gene_synonym="GRMZM2G146246; GST3; gst3a; gst3b; gst4" /note="upstream in-frame stop codon" CDS 135..800 /gene="LOC541990" /gene_synonym="GRMZM2G146246; GST3; gst3a; gst3b; gst4" /EC_number="2.5.1.18" /note="GSTIII; phi073; Gst-III; GST class-phi member 3; glutathione S-transferase4; Glutathione...
Synonym: GRMZM2G146246; GST3; gst3a; gst3b; gst4
NM_001111641.2 - Zea mays - NCBI

Data Export:

下記より最大10000件まで検索結果を取得できます。

Debug Info:

Redirect URI : https://ggrna.dbcls.jp/ja/zoo/symbol%3aGST
lang : ja | div : | spe : zoo | query_string : symbol:GST | format : html | download :

0.000 | 0.000 | search_start;
0.083 | 0.083 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=(full_search:symbol,synonym:GST)?to=0&format=json
0.150 | 0.067 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=(full_search:symbol,synonym:GST)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.159 | 0.009 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]