GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-15 17:30:08, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       XM_066974844             300 bp    mRNA    linear   PLN 31-JUL-2024
DEFINITION  Lodderomyces beijingensis 60S ribosomal protein eL36
            (LODBEIA_P46040), partial mRNA.
ACCESSION   XM_066974844
VERSION     XM_066974844.1
DBLINK      BioProject: PRJNA1107285
            BioSample: SAMEA115394517
            Sequence Read Archive: ERR12735128, ERR12735329
KEYWORDS    RefSeq.
SOURCE      Lodderomyces beijingensis
  ORGANISM  Lodderomyces beijingensis
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Lodderomyces.
REFERENCE   1  (bases 1 to 300)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JUL-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2
  AUTHORS   Brejova,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAR-2024) Comenius University, Faculty of
            Mathematics, Physics and Informatics, Computational Biology Group,
            Mlynska dolina, Bratislava 842 48, Slovakia
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_089974).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..300
                     /organism="Lodderomyces beijingensis"
                     /mol_type="mRNA"
                     /strain="CBS 14171"
                     /isolation_source="gut of a scarab beetle Anomala sieversi
                     (Rutelidae) in Central China, Liu et al 2016"
                     /type_material="holotype of Lodderomyces beijingensis"
                     /db_xref="taxon:1775926"
                     /chromosome="5"
     gene            <1..>300
                     /locus_tag="LODBEIA_P46040"
                     /db_xref="GeneID:92209800"
     CDS             1..300
                     /locus_tag="LODBEIA_P46040"
                     /codon_start=1
                     /transl_table=12
                     /product="60S ribosomal protein eL36"
                     /protein_id="XP_066831542.1"
                     /db_xref="GeneID:92209800"
                     /translation="
MAKSGIAVGLNKGHKTTAKEVAPKISYRKGALSQRTVFVRSIVSEVSGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRALRKVEEMNKIIAESRRH"
ORIGIN      
atggctaagtctggaattgctgtcggtttaaacaagggtcacaagactaccgctaaggaagttgcacccaaaatctcatacagaaaaggagctttgtctcaaagaaccgttttcgttagatcaatcgtctcggaagtctctggattggccccatacgaaagaagattgattgaattgatcagaaacgctggtgaaaagagagccaagaagttggccaagaagagattgggtacccacaagagagctttgagaaaagttgaagagatgaacaagattattgctgaatctagaagacactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]