GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-15 17:59:59, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       XM_066527325             773 bp    mRNA    linear   PLN 17-JUL-2024
DEFINITION  PREDICTED: Miscanthus floridulus homeobox protein knotted-1-like 5
            (LOC136534980), mRNA.
ACCESSION   XM_066527325
VERSION     XM_066527325.1
DBLINK      BioProject: PRJNA1133069
KEYWORDS    RefSeq.
SOURCE      Miscanthus floridulus
  ORGANISM  Miscanthus floridulus
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD
            clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae;
            Miscanthus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_027098312) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_019320115.1-RS_2024_07
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 07/10/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..773
                     /organism="Miscanthus floridulus"
                     /mol_type="mRNA"
                     /cultivar="M001"
                     /db_xref="taxon:154761"
                     /chromosome="Unknown"
                     /tissue_type="leaf"
                     /dev_stage="adult plants"
                     /geo_loc_name="China: Hunan"
     gene            1..773
                     /gene="LOC136534980"
                     /note="homeobox protein knotted-1-like 5; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 14 Proteins"
                     /db_xref="GeneID:136534980"
     CDS             7..447
                     /gene="LOC136534980"
                     /codon_start=1
                     /product="homeobox protein knotted-1-like 5"
                     /protein_id="XP_066383422.1"
                     /db_xref="GeneID:136534980"
                     /translation="
MVGSSEDKPSSGDTDATDLGQEHSSRLADRELKEMLLKKYSGRLSRLRSEFLKKRKKGKLPKDARSALMDWWNTHYRWPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRHWKPSEDMRFALMEGVTGGGSSSGTTLYFDTGTIGP"
     misc_feature    97..162
                     /gene="LOC136534980"
                     /note="ELK domain; Region: ELK; pfam03789"
                     /db_xref="CDD:427504"
     misc_feature    220..336
                     /gene="LOC136534980"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
ORIGIN      
gatgaaatggtggggtcttctgaggacaaaccaagctcaggagacacagacgcgacggacctgggtcaggagcacagctcacggttggctgaccgtgagctcaaggagatgctgctgaagaagtacagcggccgtctcagccggctgcggtccgagttcctgaagaagaggaagaaagggaagctaccaaaggatgctcggtcggcgctgatggactggtggaacacgcattaccgctggccgtaccctacggaagaggataaggtgaggctggcggcaatgactgggctggacccgaaacagataaacaactggttcatcaaccagcggaagcggcactggaagccatcggaggacatgcggttcgcgctcatggagggcgtcaccggaggcggatcatcctccgggacgacgctgtacttcgacacgggcacgatcgggccgtgatcgactctctgacgacactagtttcggcaggcgaaagatacacatttactgggcaaatagtgtttgcattgcagttgaactgcactgcactgcaccgcgccgccaatggggtaattgttggttgatatggagattagtcacatgatgaaccaataaccgctgtcattttgtcggatttattgtgtatatgggcgacaacgtgtcggtacactgcacatagtatgtagtactgctacaagggagttgctgtccagtccagatggcctgtaaagactctgtctgaaagtaccataacaattatgagcttgttggctttttttggtttc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]