GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-15 17:40:48, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       XM_064994330             303 bp    mRNA    linear   PLN 03-MAY-2024
DEFINITION  Saccharomycopsis crataegensis ribosomal 60S subunit protein L36A
            (DASC09_007270), partial mRNA.
ACCESSION   XM_064994330
VERSION     XM_064994330.1
DBLINK      BioProject: PRJNA1107242
            BioSample: SAMD00197834
            Sequence Read Archive: DRR212821, DRR212827
KEYWORDS    RefSeq.
SOURCE      Saccharomycopsis crataegensis
  ORGANISM  Saccharomycopsis crataegensis
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycopsidaceae; Saccharomycopsis.
REFERENCE   1
  AUTHORS   Mure,A., Sugiura,Y., Maeda,R., Honda,K., Sakurai,N., Takahashi,Y.,
            Watada,M., Katoh,T., Gotoh,A., Gotoh,Y., Taniguchi,I., Nakamura,K.,
            Hayashi,T., Katayama,T., Uemura,T. and Hattori,Y.
  TITLE     Identification of key yeast species and microbe-microbe
            interactions impacting larval growth of Drosophila in the wild
  JOURNAL   Elife 12, 90148 (2023)
   PUBMED   38150375
  REMARK    DOI:10.7554/eLife.90148
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 303)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAY-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 303)
  AUTHORS   Mure,A. and Hattori,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-JUN-2023) Contact:Yukako Hattori Kyoto University;
            Yoshida Konoe-cho, Sakyo-ku, Kyoto, Kyoto 606-8501, Japan:Osaka
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_027043819).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..303
                     /organism="Saccharomycopsis crataegensis"
                     /mol_type="mRNA"
                     /strain="SC-9"
                     /host="Drosophila melanogaster"
                     /db_xref="taxon:43959"
                     /chromosome="Unknown"
                     /geo_loc_name="Japan:Osaka"
                     /collection_date="2017-11-02"
     gene            <1..>303
                     /locus_tag="DASC09_007270"
                     /db_xref="GeneID:90071381"
     CDS             1..303
                     /locus_tag="DASC09_007270"
                     /note="ID:gene_00727;
                     source:AUGUSTUS"
                     /codon_start=1
                     /transl_table=12
                     /product="ribosomal 60S subunit protein L36A"
                     /protein_id="XP_064850402.1"
                     /db_xref="GeneID:90071381"
                     /translation="
MAKSGIAVGLNKGHVVTSKAVAPKISYRKGALSKRTSFVRDIVREVGGLAPYERRLIELLRNSGEKRAKKLAKKRLGTLKRAKAKLEEINKIMAEQRRHH"
ORIGIN      
atggctaaatctggtattgctgttggtttgaacaaaggtcacgtcgtcacctccaaggctgttgccccaaagatttcctacagaaagggtgctctctccaagagaacttcttttgtcagagatattgtcagagaagtcggtggtttggctccatacgaaagaagattgattgaattgttgagaaactctggtgaaaagagagctaagaagttggccaagaagagattgggtactttgaagagagctaaggccaagttggaagaaatcaacaagatcatggctgaacaaagaagacaccactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]