LOCUS       XM_055080245             255 bp    mRNA    linear   MAM 14-APR-2023
DEFINITION  PREDICTED: Physeter catodon non-histone chromosomal protein
            HMG-14-like (LOC102973125), mRNA.
ACCESSION   XM_055080245
VERSION     XM_055080245.1
DBLINK      BioProject: PRJNA434122
KEYWORDS    RefSeq.
SOURCE      Physeter catodon (sperm whale)
  ORGANISM  Physeter catodon
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Whippomorpha;
            Cetacea; Odontoceti; Physeteridae; Physeter.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_041231.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_002837175.3-RS_2023_04
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 04/05/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..255
                     /organism="Physeter catodon"
                     /mol_type="mRNA"
                     /isolate="SW-GA"
                     /db_xref="taxon:9755"
                     /chromosome="18"
                     /sex="female"
                     /tissue_type="muscle"
                     /dev_stage="adult"
     gene            1..255
                     /gene="LOC102973125"
                     /note="non-histone chromosomal protein HMG-14-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 20 Proteins"
                     /db_xref="GeneID:102973125"
     CDS             1..255
                     /gene="LOC102973125"
                     /codon_start=1
                     /product="non-histone chromosomal protein HMG-14-like"
                     /protein_id="XP_054936220.1"
                     /db_xref="GeneID:102973125"
                     /translation="

MPKKKVSSAEGAVKEEPKKRLARLSAKPAPAKVETKPKKAAGKDTSSDKKCKPKGKGGAKAKQAEMANQATKEDLPAENGETKN"

     misc_feature    4..252
                     /gene="LOC102973125"
                     /note="HMG14 and HMG17; Region: HMG14_17; pfam01101"
                     /db_xref="CDD:460064"
ORIGIN      

atgcccaagaagaaggtcagctccgctgagggggcagtgaaggaggagcccaagaagagattggcaaggttgtcagctaaaccggctcctgcaaaagtggaaacgaagccaaaaaaggcagcaggaaaggatacatcttcagacaaaaagtgcaaaccaaagggaaaagggggagcaaaggcaaaacaggctgaaatggctaaccaagcgactaaagaagacttacctgcagaaaatggagaaactaaaaactag

//