LOCUS       XM_049016968            2115 bp    mRNA    linear   VRT 12-JUL-2022
DEFINITION  PREDICTED: Brienomyrus brachyistius nascent polypeptide-associated
            complex subunit alpha, muscle-specific form-like (LOC125744763),
            mRNA.
ACCESSION   XM_049016968
VERSION     XM_049016968.1
DBLINK      BioProject: PRJNA854133
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Brienomyrus brachyistius
  ORGANISM  Brienomyrus brachyistius
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Osteoglossocephala;
            Osteoglossomorpha; Osteoglossiformes; Mormyridae; Brienomyrus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_064533) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: Brienomyrus brachyistius Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..2115
                     /organism="Brienomyrus brachyistius"
                     /mol_type="mRNA"
                     /isolate="T26"
                     /db_xref="taxon:42636"
                     /chromosome="1"
                     /sex="male"
                     /tissue_type="skeletal muscle"
     gene            1..2115
                     /gene="LOC125744763"
                     /note="nascent polypeptide-associated complex subunit
                     alpha, muscle-specific form-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:125744763"
     CDS             1..2115
                     /gene="LOC125744763"
                     /codon_start=1
                     /product="nascent polypeptide-associated complex subunit
                     alpha, muscle-specific form-like"
                     /protein_id="XP_048872925.1"
                     /db_xref="GeneID:125744763"
                     /translation="

MQPISLEPRAIPTLQPISLQPLALPILQPVSPQPPAIPTLQPWSLQPLALPTLQPWSLQPLALPTLQPVSLQPLALPTRQPISLQPLALPTLQPISLQPLALPIMQPVSPQPPAIPTLQPVSLQPLALPTLQPVSPQPPAIPTLQPWSLQPLALPTLQPISLQPLALPTLQPISLQPLALPTLQPISLQPLALPTLQPISLQPLALPTLQPVSPQPPAIPILQPAPSTALSSATGAPARPSALQQAHQHGLQLCNRRPSTALSSVTGAQHGPQLCNRRTSTALSSATGAPARLSALQQAPSTALSSVTGAPARPSALQQAPQHGPQLCNRRPSTALSSATGAQHGPQLCNRRPARPLALQQAHQHGPQLCNRRPARPSALQQAHQHGPQLCNRRTSTALSSATGAPARPSALQQAPSTALSSVTGAPARPSALQQAPQHGPQLCNRGPARPSALQQAPSTALSSAPSTALSSATGAPARPSALQQAHQHGLQLYNRRPSTALSSVTGAQHGPQLCNRRTSTALSSATGAPARLSALQQAPSTALSSVTGAPARPSALQQAPQHGPQLCNRRPARPSALQQAPSTALSSVTGAQHGPQLCNRCPSTALSSVTGAQHGPQLCNRRPSTALSSATGAQHGPQLCNRRPARPLALQQAHQHGPQLCNRRPARPSALQQAHQHGPQLCNRRTSTALSSATGAPARPSAL"

     misc_feature    <22..1323
                     /gene="LOC125744763"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     misc_feature    <43..>576
                     /gene="LOC125744763"
                     /note="DNA translocase FtsK; Provisional; Region:
                     PRK10263"
                     /db_xref="CDD:236669"
     misc_feature    <889..2103
                     /gene="LOC125744763"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
ORIGIN      

atgcagcccatctcactggagcctcgtgccatacccactctgcagcctatctcactgcagcctctggccttacccattctgcagcccgtctcaccacaacctcctgccatacctactctgcagccctggtcactgcagcctctggccttacccactctgcagccctggtcactgcagcctctggccttacccactctgcagcccgtatcactgcagcctctggccttacccactcggcaacccatctcactgcagcctctggccttacccactctgcagcctatctcactgcagcctctggccttacccattatgcagcccgtctcaccacagcctcctgccatacctactctgcagcccgtgtcactgcagcctctggccttacccactctgcagcccgtctcaccacagcctcctgccatacctactctgcagccctggtcactgcagcctctggccttacccactctgcagcccatctcactgcagcctctggccttacccactctgcagcccatctcactgcagcctctggccttacccactctgcagcccatctcactgcagcctctggccttacccactctgcagcctatctcactgcagcctctggccttacccactctgcagcccgtctcaccacagcctcctgccatacctattctgcagcccgcgcccagcacggccctcagctctgcaacaggcgcaccagcacggccctcagctctgcaacaggcgcaccagcacggccttcagctctgcaacaggcgccccagcacggccctcagctctgtaacaggtgcccagcacggccctcagctctgtaacaggcgcaccagcacggccctcagctctgcaacaggcgcaccagcacggctctcagctctgcaacaggcgcccagcacggctctcagctctgtaacaggcgcaccagcacggccctcagctctgcaacaggcgccccagcacggccctcagctctgtaacaggcgccccagcacggccctcagctctgcaacaggcgcccagcacggccctcagctctgtaacaggcgcccagcacggcccttagctctgcaacaggcgcaccagcacggccctcagctctgtaacaggcgcccagcacggccctcagctctgcaacaggcgcaccagcacggccctcagctctgcaacaggcgcaccagcacggccctcagctctgcaacaggcgccccagcacggccctcagctctgcaacaggcgcccagcacggccctcagctctgtaacaggcgcaccagcacggccctcagctctgcaacaggcgccccagcacggccctcagctctgtaacaggggcccagcacggccctcagctctgcaacaggcgcccagcacggccctcagctctgcgcccagcacggccctcagctctgcaacaggcgcaccagcacggccctcagctctgcaacaggcgcaccagcacggccttcagctctacaacaggcgccccagcacggccctcagctctgtaacaggtgcccagcacggccctcagctctgtaacaggcgcaccagcacggccctcagctctgcaacaggcgcaccagcacggctctcagctctgcaacaggcgcccagcacggctctcagctctgtaacaggcgcaccagcacggccctcagctctgcaacaggcgccccagcacggccctcagctctgtaacaggcgcccagcacggccctcagctctgcaacaggcgcccagcacggccctcagctctgtaacaggcgcccagcatggccctcagctctgtaacaggtgccccagcacggccctcagctctgtaacaggtgcccagcacggccctcagctctgtaacaggcgccccagcacggccctcagctctgcaacaggcgcccagcacggccctcagctctgtaacaggcgcccagcacggcccttagctctgcaacaggcgcaccagcacggccctcagctctgtaacaggcgcccagcacggccctcagctctgcaacaggcgcaccagcacggccctcagctctgcaacaggcgcaccagcacggccctcagctctgcaacaggcgccccagcacggccctcagctctgtaa

//