LOCUS       XM_048656001             618 bp    mRNA    linear   INV 11-JUN-2022
DEFINITION  PREDICTED: Athalia rosae involucrin-like (LOC125501099), mRNA.
ACCESSION   XM_048656001
VERSION     XM_048656001.1
DBLINK      BioProject: PRJNA846876
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Athalia rosae (coleseed sawfly)
  ORGANISM  Athalia rosae
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Tenthredinoidea;
            Athaliidae; Athalia.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_064030) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Athalia rosae Annotation Release 103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..618
                     /organism="Athalia rosae"
                     /mol_type="mRNA"
                     /db_xref="taxon:37344"
                     /chromosome="5"
     gene            1..618
                     /gene="LOC125501099"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:125501099"
     CDS             1..618
                     /gene="LOC125501099"
                     /codon_start=1
                     /product="involucrin-like"
                     /protein_id="XP_048511958.1"
                     /db_xref="GeneID:125501099"
                     /translation="

MEFTRHPSVIQDELNQVDRLKHEFKQLDCLKDKLNQVDRLKHEFKQLDCLKDELNQLDLLKHKFNQLDCLRDKLNQVDRLKNNFNQLDRLKHELNQLDGLKDKLNQVDRLKHEFKQLDCLKDELNQLDLLKHKFNQLDCLRDKLNQVDRLKNNFNQLDRLKHELNQLDGLKDKLNQVDRLKHEFKQLDCLKDELNQLDRLKHNCN"

     misc_feature    73..>609
                     /gene="LOC125501099"
                     /note="Uncharacterized conserved protein YhaN, contains
                     AAA domain [Function unknown]; Region: YhaN; COG4717"
                     /db_xref="CDD:443752"
ORIGIN      

atggagttcactagacacccgagcgtgatacaagatgaattgaatcaagttgatcgcctgaaacacgaattcaagcaacttgattgcctgaaagataaattgaatcaagttgatcgcctgaaacacgaattcaagcaacttgattgcctgaaagatgaattgaatcaacttgatctcctcaaacacaaattcaaccaacttgattgcctgagagataaattgaatcaagttgatcgcctgaaaaacaatttcaaccaacttgatcgcctgaaacacgaactcaaccaacttgatggccttaaagataaattgaatcaagttgatcgcctgaaacacgaattcaagcaacttgattgcctgaaagatgaattgaatcaacttgatctcctcaaacacaaattcaaccaacttgattgcctgagagataaattgaatcaagttgatcgcctgaaaaacaatttcaaccaacttgatcgcctgaaacacgaactcaaccaacttgatggccttaaagataaattgaatcaagttgatcgcctgaaacacgaattcaagcaacttgattgcctgaaagatgaattgaatcaacttgatcgcctgaaacacaattgcaactaa

//