LOCUS       XM_048511244             838 bp    mRNA    linear   VRT 02-JUN-2022
DEFINITION  PREDICTED: Sphaerodactylus townsendi Fc epsilon receptor Ig
            (FCER1G), mRNA.
ACCESSION   XM_048511244
VERSION     XM_048511244.1
DBLINK      BioProject: PRJNA788548
KEYWORDS    RefSeq.
SOURCE      Sphaerodactylus townsendi
  ORGANISM  Sphaerodactylus townsendi
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Lepidosauria; Squamata; Bifurcata; Gekkota; Sphaerodactylidae;
            Sphaerodactylus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_059425) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Sphaerodactylus townsendi Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..838
                     /organism="Sphaerodactylus townsendi"
                     /mol_type="mRNA"
                     /isolate="TG3544"
                     /db_xref="taxon:933632"
                     /sex="male"
                     /tissue_type="blood, liver"
                     /dev_stage="adult"
                     /collection_date="2012/2019"
                     /collected_by="Pinto, Daza, Gamble"
                     /linkage_group="LG01"
     gene            1..838
                     /gene="FCER1G"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 4 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:125440998"
     CDS             78..398
                     /gene="FCER1G"
                     /codon_start=1
                     /product="high affinity immunoglobulin epsilon receptor
                     subunit gamma"
                     /protein_id="XP_048367201.1"
                     /db_xref="GeneID:125440998"
                     /translation="

MKLHLFTALLVLLTAEEADALKEPEICYILDGILFAYGITLTFLYCRLKIQYRKKSKQLQDSSAIYEKVEGIYTGLVTPEGDTYTPLKLTKPEPPSKTPEEEFEVE"

     misc_feature    144..230
                     /gene="FCER1G"
                     /note="T-cell surface glycoprotein CD3 zeta chain; Region:
                     TCR_zetazeta; pfam11628"
                     /db_xref="CDD:463313"
ORIGIN      

gcagcgcatagggctggtggttggcttcacatctgtcgggctcacctcagcagaacgaatccacccaagcctccatcatgaagctacatctcttcacagccctcttggttctcctaacagctgaggaagcagacgccctgaaggaacctgagatatgttacattttggatgggattctctttgcctacggcatcactctcaccttcctctactgtcgactgaagattcaataccgaaagaaatcaaaacagttacaggactcttcggcaatctatgagaaagtggaaggaatctatacaggccttgtcacgcctgaaggtgacacctacacacccctcaagcttaccaagcctgaaccaccgagtaaaacccctgaagaagagtttgaagtggagtaggccctgcactgctgtggcttgcggaaacctttggctgacatctgaaacctgcaaagccgcgtttgatgtgggacaactgtcgagcaatcctcgctacaccttcagggaagactctgtcctgttttgtgccctgaccaagtggctttgatgagggggagccttgttcgtggtagctgccgcttgctcttttaagccaatgcctattaggatgcggcgtgggctttttgttaactccaccgggtgctctcacgagtacctctcaaagcctattcaattgtagggcaaaactagtttgtccatgatcccgtacaaccccagggaactttatatacccttatacataattgcctaagggatggaatgtccgacgactaacccccagccaatgggtgtgcaggactcacaacattccatccaattcccgcccaccttcccccaac

//