LOCUS       XM_048427411            1442 bp    mRNA    linear   ROD 28-MAY-2022
DEFINITION  PREDICTED: Myodes glareolus alkaline ceramidase 1 (Acer1),
            transcript variant X2, mRNA.
ACCESSION   XM_048427411
VERSION     XM_048427411.1
DBLINK      BioProject: PRJNA842339
KEYWORDS    RefSeq.
SOURCE      Myodes glareolus (Bank vole)
  ORGANISM  Myodes glareolus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Cricetidae; Arvicolinae; Myodes.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_025965346) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Myodes glareolus Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1442
                     /organism="Myodes glareolus"
                     /mol_type="mRNA"
                     /db_xref="taxon:447135"
                     /chromosome="Unknown"
     gene            1..1442
                     /gene="Acer1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 1 sample
                     with support for all annotated introns"
                     /db_xref="GeneID:125395759"
     CDS             77..733
                     /gene="Acer1"
                     /codon_start=1
                     /product="alkaline ceramidase 1 isoform X2"
                     /protein_id="XP_048283368.1"
                     /db_xref="GeneID:125395759"
                     /translation="

MSSIFAYQSSEVDWCESNFQHSELVAEFYNTFSNVFFLIFGPIIMFLMHPYAQKRTWAIYGVSVLFMVIGLFSMYFHMTLSFLGQLLDEISILWLLASGYSVWMPRCYFPKFIKGNRTSNGDLRHLIEMSVILWAAALTSWISDRVLCSFWQRIHFSYMHSIWHVLISITFPYGIVTMALLDAKYEMPGQTLKVHYWPRDSWFIGLPYVEIQDNDKNC"

     misc_feature    92..706
                     /gene="Acer1"
                     /note="Region: Ceramidase; pfam05875"
                     /db_xref="CDD:461766"
ORIGIN      

ggcactcgtaagctcactcactctgctggcgcgcctctgccaggcacaagtcgcgtgcactgattccagagcaaagatgtccagcatctttgcctatcagagctctgaggtggattggtgcgagagtaatttccagcactcggaactggtggctgagttctacaatacgttcagcaatgtgttcttcctcatctttggacctatcataatgttcctcatgcatccttacgcccagaaacggacctgggccatctatggcgtctcggtcctcttcatggttataggtttgttctccatgtatttccacatgacactcagctttttggggcagctgctggatgagatttccatcctgtggttgttggccagtggctacagcgtgtggatgccccgttgctacttcccgaagttcatcaaaggaaacaggaccagcaatggggaccttcggcatctgattgagatgtctgtgatcttatgggctgctgcgctgaccagctggataagcgaccgtgtgctttgcagtttctggcagcggattcacttctcctacatgcacagcatttggcatgtcctcataagcatcaccttcccttacggtatcgtgaccatggcccttttggatgcaaagtacgagatgccaggtcaaaccctcaaagtccactactggccccgggatagttggttcattgggctgccctatgtggagatccaggacaacgacaaaaactgctgagccttggtggattctccactctccgaccagccactcagatgtctgcgctctgaggatagaggaccaggacttcagttaggacgcttgtcacttctcctttccctcattcacactccttgtcctgctgtggccacaagatggactttcttgtggctcagagcactaatttggtgactgaggggcagggactgcctggtgtgctgcatgactggcctgtgtcctctttcagcctttggaaccgcagcttctccacagccattgatgcggtgatgggtgggtagggtaagtggttgatacagcacctgcttgaagcacgacgcttgttctctggcatctcacacatctggaactatttatgagtgttatagattcaatgtgggcatgaccgtgttctgggaaggtggggagtatccagaaaacattctaggctccaccgctaggtgcagagatatgtactctttgaaccattcacacccaggccatggaggcacacaagaaccatgggagagaacagagggccaacctgagtgacatcacggagcgggatgtgagaggggagcatggtggccattctaggcacttagaaggaaggctactgagcacaggtggtttccacggtgactaacagtacggaaatagacatgcctacatctgactttctgctccacagtattcagcctgcatagtcatgagggtgtggcctttccta

//