LOCUS       XM_048236617             607 bp    mRNA    linear   VRT 15-MAY-2022
DEFINITION  PREDICTED: Alosa alosa Fc epsilon receptor IgFc epsilon receptor Ig
            (fcer1g), mRNA.
ACCESSION   XM_048236617
VERSION     XM_048236617.1
DBLINK      BioProject: PRJNA834759
KEYWORDS    RefSeq.
SOURCE      Alosa alosa (allis shad)
  ORGANISM  Alosa alosa
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Clupei; Clupeiformes;
            Clupeoidei; Clupeidae; Alosa.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_063212) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Alosa alosa Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..607
                     /organism="Alosa alosa"
                     /mol_type="mRNA"
                     /isolate="M-15738"
                     /db_xref="taxon:278164"
                     /chromosome="24"
                     /sex="male"
                     /tissue_type="blood"
                     /dev_stage="adult"
                     /ecotype="Scorff River"
                     /geo_loc_name="France:Pont-Scorff, Scorff River"
                     /collection_date="18-Apr-2017"
                     /collected_by="Yann Guiguen, INRAE LPGP, 35000 Rennes,
                     France"
     gene            1..607
                     /gene="fcer1g"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 8 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 10 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:125289663"
     CDS             134..406
                     /gene="fcer1g"
                     /codon_start=1
                     /product="high affinity immunoglobulin epsilon receptor
                     subunit gamma"
                     /protein_id="XP_048092574.1"
                     /db_xref="GeneID:125289663"
                     /translation="

MKTSRTLLSAIPLWMCFDHAAAISEPQICYILDSILFLYGLILTVLYCRLKWIQGKEAYPVKKQAEGIYEGLSPHAQDTYETIQLKKGMK"

     misc_feature    206..286
                     /gene="fcer1g"
                     /note="T-cell surface glycoprotein CD3 zeta chain; Region:
                     TCR_zetazeta; pfam11628"
                     /db_xref="CDD:463313"
ORIGIN      

agacacacacacaccacttctttccgtcagttcaaacgcccgactcctgagaagcctgaacgccactctcactccgctccgctctcactccatcaccatcgttcactcgggttctgtgagtgtgttttggaacatgaagacctcacgcaccctcctctccgccatacctctgtggatgtgtttcgaccacgcagctgccatctccgagccccagatttgctacatcttggacagcatcctcttcctctatggcctcatcctcactgtgctctactgtcgactcaagtggattcagggtaaggaggcctatcctgtgaagaaacaggcagagggcatatatgaaggtctgtcccctcacgcccaggacacctacgagaccatccagctgaagaaagggatgaagtagagagagaaagatgagaagaagaagagagggataaagagatgcgagaaaaggagagaatttgctccatgtaactttacagcagcgacttatctgtccaatatgctcctacaggcttacttgagatggcaaatgtgtgtgtgtgtgtgtgtgtgtgtgagtgagagagagagagagagagagagagtatgagagagagagaga

//