2024-11-15 19:00:50, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_047628064 1177 bp mRNA linear INV 08-APR-2022 DEFINITION PREDICTED: Penaeus chinensis uncharacterized LOC125035825 (LOC125035825), mRNA. ACCESSION XM_047628064 VERSION XM_047628064.1 DBLINK BioProject: PRJNA822080 KEYWORDS RefSeq. SOURCE Penaeus chinensis ORGANISM Penaeus chinensis Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Multicrustacea; Malacostraca; Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea; Penaeidae; Penaeus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_061838) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Penaeus chinensis Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1177 /organism="Penaeus chinensis" /mol_type="mRNA" /isolation_source="conservation base of Haifeng Aquaculture Co., Ltd." /db_xref="taxon:139456" /chromosome="20" /sex="male" /tissue_type="muscle" /geo_loc_name="China: Weifang of Shandong Province" /collection_date="2019-12" /breed="Huanghai No. 1" gene 1..1177 /gene="LOC125035825" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:125035825" CDS 284..1042 /gene="LOC125035825" /codon_start=1 /product="uncharacterized protein LOC125035825" /protein_id="XP_047484020.1" /db_xref="GeneID:125035825" /translation="
MRNIVPDSMGMDELRRNIVPVSIGKEEALQSKNIVPDSMGKDELRRNIVPVSIGKEEALQSKNIVPDSMGMDELRRNIVPVSIGKEEALQSKNIVPDSMAKDELRRNIVPVSIGKEEALQSKNIVPDSMAKDELRRNIVPVSIGKEEALQSKNIVPDSMAKDELRRNIVPVSIGKEEALQSKNIVPDSMAKDELRRNIVPVSIGKEEALQSKNIVPDSMAKDELRAEHRPSQYWEGGGTAVQEHRPRQYGEG"
ORIGIN
ttatttaaaactattgattaatcttttgcttttgagtgcaatttcttgtgtagatctcaacaggataaacaccactcacaacgagacgaccctgtctgacattgtctcctaggtcccccaagccatactgaccctcgagggcatagcgaatggaacggtcctagccaatgtcaccaccggtaagcggagcaccatcccagagaagggggcactccggctaaataaaacggtcctggccaatgccaccaacattgtcagtgattaagtgaacttcacccctggtatgcggaacatcgtcccagacagtatggggatggatgaactgcggcggaacatcgtcccagtcagtattgggaaggaggaggcactgcagtccaagaacatcgtcccagacagtatggggaaggatgaactgcggcggaacatcgtcccagtcagtattgggaaggaggaggcactgcagtccaagaacatcgtcccagacagtatggggatggatgaactgcggcggaacatcgtcccagtcagtattgggaaggaggaggcactgcagtccaagaacatcgtcccagacagtatggcgaaggatgaactgcggcggaacatcgtcccagtcagtattgggaaggaggaggcactgcagtccaagaacatcgtcccagacagtatggcgaaggatgaactgcggcggaacatcgtcccagtcagtattgggaaggaggaggcactgcagtccaagaacatcgtcccagacagtatggcgaaggatgaactgcggcggaacatcgtcccagtcagtattgggaaggaggaggcactgcagtccaagaacatcgtcccagacagtatggcgaaggatgaactgcggcggaacatcgtcccagtcagtattgggaaggaggaggcactgcagtccaagaacatcgtcccagacagtatggcgaaggatgaactgcgggcggaacatcgtcccagtcagtattgggaaggaggaggcactgcagtccaagaacatcgtcccagacagtatggcgaaggatgaactgcggcggaacatcgtcccagtcagtattgggaaggaggaggcactgcagtccaagaacatcgtcccagacagtatggcgaaggatgaactgcggcggaacatcgtcccagtcagtattgggaaggaggaggc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]