GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-15 17:19:38, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       XM_046725384             360 bp    mRNA    linear   INV 14-FEB-2022
DEFINITION  PREDICTED: Haliotis rubra uncharacterized LOC124288830
            (LOC124288830), transcript variant X2, mRNA.
ACCESSION   XM_046725384
VERSION     XM_046725384.1
DBLINK      BioProject: PRJNA801670
KEYWORDS    RefSeq.
SOURCE      Haliotis rubra (blacklip abalone)
  ORGANISM  Haliotis rubra
            Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Gastropoda;
            Vetigastropoda; Lepetellida; Haliotoidea; Haliotidae; Haliotis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_025767109) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Haliotis rubra Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..360
                     /organism="Haliotis rubra"
                     /mol_type="mRNA"
                     /isolate="DU_JTF1"
                     /isolation_source="Aquaculture farm"
                     /db_xref="taxon:36100"
                     /chromosome="Unknown"
                     /tissue_type="muscle"
                     /dev_stage="adult"
                     /geo_loc_name="Australia: Jade Tiger Abalone Farm,
                     Indented Head, Victoria"
                     /collection_date="2017"
                     /collected_by="Adam Miller"
     gene            1..360
                     /gene="LOC124288830"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 19 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:124288830"
     CDS             11..355
                     /gene="LOC124288830"
                     /codon_start=1
                     /product="uncharacterized protein LOC124288830 isoform X2"
                     /protein_id="XP_046581340.1"
                     /db_xref="GeneID:124288830"
                     /translation="
MDHEYRDQVVKLSQAEDYTAFEDLIQMAGCISMVHTLSRRQEMCKAHQGFDQFCRGLETLGVLGALKHHGTRMKEVFEYEKRLLDSTTIELLFEADLAKANSNRRRQEEIVLSN"
ORIGIN      
aaaccacattatggaccacgaatacagggatcaagtggtgaagttatctcaggccgaggattacacggcctttgaagacctgattcagatggcaggttgtatatccatggtccatacgctgagcaggcgacaagaaatgtgcaaggcacatcaaggttttgaccaattctgcagaggacttgaaacgcttggcgtattaggagcgctaaaacatcatggaacacgcatgaaagaagtttttgaatatgaaaaaaggcttctggattctacaacaatagaactattgttcgaagcagatttagcaaaggccaactccaaccgacgccgccaagaagagattgttctctcaaactagagaga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]