LOCUS       XM_045982708             912 bp    mRNA    linear   MAM 04-MAR-2022
DEFINITION  PREDICTED: Meles meles Fc epsilon receptor Ig (FCER1G), mRNA.
ACCESSION   XM_045982708
VERSION     XM_045982708.1
DBLINK      BioProject: PRJNA796981
KEYWORDS    RefSeq.
SOURCE      Meles meles (Eurasian badger)
  ORGANISM  Meles meles
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia;
            Musteloidea; Mustelidae; Melinae; Meles.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_060082) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Meles meles Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..912
                     /organism="Meles meles"
                     /mol_type="mRNA"
                     /db_xref="taxon:9662"
                     /chromosome="17"
     gene            1..912
                     /gene="FCER1G"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 9 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 8 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:123927820"
     CDS             359..619
                     /gene="FCER1G"
                     /codon_start=1
                     /product="high affinity immunoglobulin epsilon receptor
                     subunit gamma"
                     /protein_id="XP_045838664.1"
                     /db_xref="GeneID:123927820"
                     /translation="

MVPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAATASYEKSDGIYTGLSTRNQETYETLKHEKPSQ"

     misc_feature    419..511
                     /gene="FCER1G"
                     /note="T-cell surface glycoprotein CD3 zeta chain; Region:
                     TCR_zetazeta; pfam11628"
                     /db_xref="CDD:463313"
     misc_feature    542..604
                     /gene="FCER1G"
                     /note="Immunoreceptor tyrosine-based activation motif;
                     Region: ITAM; smart00077"
                     /db_xref="CDD:128390"
     polyA_site      912
                     /gene="FCER1G"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      

gaggctacagtggggtctcagggaccttgaagggactgtgtcttccaggtgtatccggacgtggggtgatggccggtttagacggcctttctcaggcagggacgtccccaccacaacccatcccctggtgcctggggcttggtcactgaaggactgaggcaggagagcccagctctaactcccttagttggcccttccgggagccgcccgggctccggtgcaggaaggggaaggggccaaagctgggggaaggcggggcaggaagggggggactctgtggtcagggagccgctgagcacagctgcgcagtgccagagcgtccgatcgccggctcgcggcccttcagcccccgcccaagatggtccccgccgtggtcttgctcctgctgcttctggttgaacaagcagccgccctgggagagcctcagctctgctatatcctggatgccatcctgtttttgtatggtattgtcctcacccttctctactgccgacttaagatccaggtgcggaaggcggccacagccagctacgagaaatcagacggcatttacacgggcctgagcacccggaaccaggagacgtacgagaccctgaagcatgagaaaccgtcccagtaactgtagaacagatgtccctggccacgtccttcccctcctcgttctcttcctaacccccatggttggcatcacatatgtccctgttagtgccagccgacctcacctctgaaatgatgctacgttccccattattggacaccggtgggtcttcctccccaccggacttctcagatgctaatcattaatgtgtatattctgatctcactgccgttccccagccctctctttcctgtctcccactcccactcaacaatggaaagagagtatcaccaataaagccatcagagcctgga

//