GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-15 18:44:52, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       XM_037780765            2837 bp    mRNA    linear   VRT 19-NOV-2020
DEFINITION  PREDICTED: Sebastes umbrosus CD209 antigen-like protein C
            (LOC119494693), transcript variant X1, mRNA.
ACCESSION   XM_037780765
VERSION     XM_037780765.1
DBLINK      BioProject: PRJNA675852
KEYWORDS    RefSeq.
SOURCE      Sebastes umbrosus (honeycomb rockfish)
  ORGANISM  Sebastes umbrosus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Eupercaria; Perciformes; Scorpaenoidei;
            Sebastidae; Sebastinae; Sebastes.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_051277.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Sebastes umbrosus Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2837
                     /organism="Sebastes umbrosus"
                     /mol_type="mRNA"
                     /isolate="fSebUmb1"
                     /db_xref="taxon:72105"
                     /chromosome="9"
                     /sex="male"
                     /tissue_type="muscle"
                     /dev_stage="adult"
                     /geo_loc_name="USA: California coast"
                     /lat_lon="33.599833 N 118.265167 W"
                     /collection_date="05-Oct-2017"
                     /collected_by="University of Washington"
     gene            1..2837
                     /gene="LOC119494693"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 6 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:119494693"
     CDS             90..1526
                     /gene="LOC119494693"
                     /codon_start=1
                     /product="C-type lectin domain family 4 member M-like
                     isoform X1"
                     /protein_id="XP_037636693.1"
                     /db_xref="GeneID:119494693"
                     /translation="
MQLMEVDDDELHVNKNLTMQGLLNSVDFQRKKQPSRCASVCLGLLCAVLLAGNIGQLVYYEIISRSASADPTQASYIQGGQEQSSYDALTAERKQLDARLTNLTKEKDLLQQSYSSVTTERDEFKASFNNLKNESDQLQVSYNTLKQESDQLQTNKDQLQTKYSSLQRQKDELQTNKDQLQTRYSSLQRQKDELQTNKDQLQTRYSSLQREKDELQTNKDQLQTRYSSLQRQKDELQTNKDQLQTRYSSLLKQKDELQTLSVTLRANRDQLQSNYSSLKINKDQLQRSYNTLSLSKIFLQTRYNSLEKDKERLQSSYNTLQREKEQLQTKYTSLAAARDQLQKKIDKVRAKPCQTGWSKFDISCYFVSNLEKNWTQSRQYCIAEGADLVVIDSRDEQAFVNGLLDDGKNAWTGMTDSIIEGIWMWVDGTPVTTTYWGEDQPNSYDGNQDCGETVQKSLGVGEWNDDGCFGDQNFICEK"
     misc_feature    <330..>1142
                     /gene="LOC119494693"
                     /note="Chromosome segregation ATPase Smc [Cell cycle
                     control, cell division, chromosome partitioning]; Region:
                     Smc; COG1196"
                     /db_xref="CDD:440809"
     misc_feature    1146..1523
                     /gene="LOC119494693"
                     /note="C-type lectin-like domain (CTLD) of the type found
                     in human dendritic cell (DC)-specific intercellular
                     adhesion molecule 3-grabbing non-integrin (DC-SIGN) and
                     the related receptor, DC-SIGN receptor (DC-SIGNR); Region:
                     CLECT_DC-SIGN_like; cd03590"
                     /db_xref="CDD:153060"
     misc_feature    order(1314..1316,1407..1409,1413..1415,1431..1433,
                     1449..1454,1479..1490)
                     /gene="LOC119494693"
                     /note="carbohydrate binding site; other site"
                     /db_xref="CDD:153060"
     misc_feature    order(1335..1337,1347..1349,1416..1418,1431..1436)
                     /gene="LOC119494693"
                     /note="calcium binding site 1 [ion binding]; other site"
                     /db_xref="CDD:153060"
     misc_feature    order(1347..1349,1434..1436)
                     /gene="LOC119494693"
                     /note="calcium binding site 3 [ion binding]; other site"
                     /db_xref="CDD:153060"
ORIGIN      
tgttgtaaatcagcagcatcttcatgtgaatgcagtcatactggtactgacttcttctctgatccaagggaaaacagacctttatcagaatgcagttaatggaagttgatgacgatgagctacatgtgaataagaacctcacaatgcaaggcctcctcaactcagttgattttcagaggaagaagcagccctctagatgtgcgtccgtgtgtcttggattactgtgtgctgtcctgttggctggtaacataggacagcttgtctactatgagataatcagccgctccgcgtcagcagacccaacgcaggccagctacattcaaggaggtcaagagcagagcagctatgatgctttaacagcagagagaaaacaattggatgccagactgactaacctgactaaagaaaaagacctgttgcagcaaagctacagctctgtgactactgaaagagatgagttcaaggccagtttcaacaatctgaaaaatgagagcgaccagttacaagtaagttacaacaccttaaaacaagagagcgatcagttacagactaataaagaccagctacagaccaagtacagtagcctgcaaagacaaaaagatgagttacagactaataaagaccagctacagaccaggtacagtagcctgcaaagacaaaaagatgagttacagacgaataaagaccagctacagaccaggtacagtagcctgcaaagagaaaaagatgagttacagactaataaagaccagctacagaccaggtacagtagcctgcaaagacaaaaagatgagttacagactaataaagaccagctacagaccaggtacagtagcctgctaaaacaaaaagatgagttacagactttgtctgttacgctgagagcaaacagagatcagttgcagagcaattactcctcactgaagattaacaaggaccagttgcaaagaagctataacacactgagtttaagtaagattttccttcagaccagatacaattcattggagaaagacaaagaacgattgcagtcgagctataatactctgcagagggaaaaagagcagttacagaccaaatacaccagtttggctgcagctagagatcagctacagaagaagatcgacaaagtgagagctaaaccctgtcagacaggctggagtaagttcgacatcagctgttactttgtttcaaatttggagaaaaactggacgcaaagccgacaatactgcatcgcagagggagcagatctagtcgtcatagacagcagggatgaacaggcatttgtcaacgggttactggatgacggcaaaaatgcctggactggtatgactgacagtattatagagggaatttggatgtgggtggacgggactccagtcaccactacgtactggggggaggaccagcccaacagctacgatgggaaccaggactgtggagaaactgtgcaaaagtcattgggagttggagaatggaacgatgacggctgttttggtgatcagaactttatctgtgagaaataatatcacaatgatttacacagttaatgatggtgtgttggactgcagttctaatgtacgtcataactaattgattatttgtattaatctgcagctgaaaatagtccccaacaaatagcgtgtttacttcagtttgctaaaatctacaatgttccgctgttttaggaaatgactgagccttttttgaaaatgatggtatacatttatggctgtttttaaagattttcatcttcagtgggaactccatagactttcagaaagtgctgagagatggacgaacacattggttttggtctttccatggggtttgtagacaataacaaaaatatataataatctcagctttattctttgatactgttaaaggctgttttcagttaatctggctgattagacctcttctcaggactgtgtgtgcatgtatagactaatgagtcacatcttcctgattctcctgttagctttgttgaacctgttaaggcgggataaattacacctttatcattcttattggtcgatgaagatttttgacctaataaatccccatcaaagctccggcccaccttcaacctgagcagaggtctaatcagacagaataactgaaatcacttgtgtgggtgttcagaggctttaaaggtcggttcacccaaattactatcgaacatatttctcatatttccacacctctagtggacatgtacgatatctatctctgagatttctgcctccagacagccaagtcttaatatattaaactttttaagctttaatgattttagacgagtacactttgatgcataacattgttaacatgttcataaatgtactatttagctgatgatttgtgtttgatgtaatggaatatgaatttcttggttgtacaaaaacgggttttactatgtgttaccgtgttctcttatgagtgtgctacatcagattcagcaaacactcctaacttcagataactgtgtaaatgcgtaaacatgatgaatgccacctgtgtggaaatgagcaatcgttcatgaaaattgtaaattaacataattaacaccccaatgataccaagtatgaatctgtttgtaggagttgttcttgaggccaattgtctagtactctactatgatattctgtggcctttggcatagctttagaaatgtgtgcaaattgccatctgtttgattaatgaaattgtatgcaaattaatgtttaacacaaataatgtatgttacaaagcacatgcatacaacatttgcatatggttttaataatttactgtatcactctgtaatgattaaaaaatactggcacaaatta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]