LOCUS       XM_032843692             414 bp    mRNA    linear   MAM 14-MAR-2020
DEFINITION  PREDICTED: Lontra canadensis late cornified envelope protein
            1A-like (LOC116858788), mRNA.
ACCESSION   XM_032843692
VERSION     XM_032843692.1
DBLINK      BioProject: PRJNA611578
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Lontra canadensis (Northern American river otter)
  ORGANISM  Lontra canadensis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia;
            Musteloidea; Mustelidae; Lutrinae; Lontra.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_022631136.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Lontra canadensis Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..414
                     /organism="Lontra canadensis"
                     /mol_type="mRNA"
                     /isolate="GAN:19392208"
                     /db_xref="taxon:76717"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="blood"
                     /dev_stage="adult"
     gene            1..414
                     /gene="LOC116858788"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 6 Proteins"
                     /db_xref="GeneID:116858788"
     CDS             1..414
                     /gene="LOC116858788"
                     /codon_start=1
                     /product="late cornified envelope protein 1A-like"
                     /protein_id="XP_032699583.1"
                     /db_xref="GeneID:116858788"
                     /translation="

MGPKVQNRSYEAFQVALAKENEAENQTSDSISEMSYQQNQQQCQSPPKCPTPKCPPKCPPKCPSISSCCSVSSGGCCSSSSGGRSCCSFGGGSSCLSHHRRHRSHCHRCQSSGCCSQPSGGSSCCGGGSSQSSGGCC"

ORIGIN      

atggggcccaaggtccaaaacaggagctatgaggccttccaggtggcacttgccaaagagaatgaggcagaaaatcaaacttccgactccatcagcgagatgtcctaccagcagaatcagcagcagtgccagtcccctcccaagtgtcccaccccgaagtgccctccaaagtgtcccccaaagtgcccctcaatctcttcttgctgcagtgtcagctctgggggctgctgcagctccagctccgggggtagaagctgctgcagttttggaggtggcagctcctgcctgagccaccacagacgacacaggtcccactgtcacagatgccagagctctggctgctgcagccagccctcagggggctccagctgctgtggagggggcagcagtcagtcctctggaggctgttgctga

//