2024-11-15 17:48:51, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_020638687 2073 bp mRNA linear VRT 24-JUN-2024 DEFINITION PREDICTED: Labrus bergylta Meis homeobox 2a (meis2a), transcript variant X12, mRNA. ACCESSION XM_020638687 VERSION XM_020638687.3 DBLINK BioProject: PRJNA1126594 KEYWORDS RefSeq. SOURCE Labrus bergylta (ballan wrasse) ORGANISM Labrus bergylta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Eupercaria; Labriformes; Labridae; Labrus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_089212) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Jun 24, 2024 this sequence version replaced XM_020638687.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963930695.1-RS_2024_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/21/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2073 /organism="Labrus bergylta" /mol_type="mRNA" /db_xref="taxon:56723" /chromosome="18" gene 1..2073 /gene="meis2a" /note="Meis homeobox 2a; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins" /db_xref="GeneID:109987574" CDS 717..1892 /gene="meis2a" /codon_start=1 /product="homeobox protein Meis2a isoform X12" /protein_id="XP_020494343.1" /db_xref="GeneID:109987574" /translation="
MAQRYDELAHYGGMDGVTASMYGDPHAPRPLPQVHHLNHGPPLHGQHYGAHAPHPNVMPTSMGSAVNDVLKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPASWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM"
misc_feature 1035..1289 /gene="meis2a" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:465140" misc_feature order(1551..1553,1680..1682,1689..1694,1701..1703) /gene="meis2a" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1590..1706 /gene="meis2a" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:428673" ORIGIN
tcacaagatttggtctctcctctctcttttctggagctgctgtaggactggctatggccaccactacttccgggatccgtcatttcattcgcccaccgctcagcgctgcgaactgactctgtttctataagcaagctagcagccaacctgccaacactcgctgacactcactcatctcagtttcgccagatagacgaaatacctacggggaaagaaaggagagatccgaatcgcaatctcttaatttcttctgcttttttttccttcttttacagtgataataaaacaagatagcgatctggaggcattaaaggagacgcggacttgcgggatgaaaacggactaaaaagattcgtccttctcttgaacatcatcaccaaccgtcattcattcattaccttgacaacctctggctttgattgacagctggagtggcaaaaagccatgagacacgacagtttagttacatgcaggttgttgatgggccgattgtaaccttcactttggcgcattttttgatttttttgcgaggaaaagggggaaaacaagaaaaattgcaaaagtcccccatgctacgatttcaactgaaccacactggcgaataggagaagtcgcaaagttggttgaaaacggaatcttgccactaaatcactttctaaccgggactgggatattaaatatacgacagattcaggagtttattggagcgcagcctgatggcgcaaaggtacgatgagctggcccattacggtgggatggacggagtcacggcgtcgatgtacggggacccgcacgctccccggccgcttccccaggtccaccacctgaaccacggaccgccgctgcacggccagcactacggagctcatgctccgcacccaaacgttatgcccaccagcatgggctccgctgtcaacgacgttttaaagagggataaagatcaaatttatggtcaccctttattcccactgctcgcgctggtttttgagaagtgcgagttggcgacgtgtactccgagggagcccggcgtagcaggcggcgatgtctgctcctcagactccttcaatgaggacattgcagtctttgccaaacaggtccgagcagaaaaacctttattttcatcaaatccagagttggacaatttgatgatacaagccatacaagtattacgatttcacctcttggaattagaaaaggtgcatgagctctgcgacaatttttgccaccggtacatcagctgtttgaaaggaaaaatgccaatagatctagttattgacgaacgggatggcagctcaaaatcagatcacgaagaactctcgggatcgtcgactaacctcgcagatcacaacccagcttcctggagagaccatgatgacgccacctccacacactcagccggcacaccggggccctccagcgggggacacgcttcgcagagcggtgacaacagcagcgaacaaggagatggcttagacaacagcgttgcatcgcctggcacaggggatgacgacgatccagacaaggataagaagaggcagaaaaagcgtggcattttccccaaggtggccactaacatcatgagggcgtggctgttccagcatctcacgcacccatacccgtctgaagagcagaagaagcagctagcccaagacacgggcctcaccatcttacaagtaaacaactggttcattaacgccaggagaagaatagtacagcccatgattgaccagtcaaatcgagcagtgagccaaggagcagcatacagtccggaaggccagccaatgggcagcttcgtgctggacggtcagcaacacatggggatccgaccagccgggcctatgagtggaatggggatgaatatgggcatggatgggcaatggcactacatgtaacctccatcttgtaaagcaaaacgcaaagaaaaagggggaagtctgccaggcatgccaggggattacgtacctcagagcggtcctatgggcatgagcatggccccgcccacctataccaaccctcatcagatgacctcccacccctcccagctccgacacggacaccctctccacgcgtacc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]