2024-11-15 17:19:03, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_017863384 1095 bp mRNA linear PRI 24-AUG-2016 DEFINITION PREDICTED: Rhinopithecus bieti VCP interacting membrane selenoprotein (VIMP), transcript variant X1, mRNA. ACCESSION XM_017863384 VERSION XM_017863384.1 DBLINK BioProject: PRJNA339282 KEYWORDS RefSeq. SOURCE Rhinopithecus bieti (black snub-nosed monkey) ORGANISM Rhinopithecus bieti Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_016826299.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Rhinopithecus bieti Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1095 /organism="Rhinopithecus bieti" /mol_type="mRNA" /isolate="Rb0" /db_xref="taxon:61621" /chromosome="Unknown" /sex="male" /tissue_type="blood" gene 1..1095 /gene="VIMP" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 57 ESTs, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 11 samples with support for all annotated introns" /db_xref="GeneID:108522926" CDS 73..681 /gene="VIMP" /codon_start=1 /product="selenoprotein S isoform X1" /protein_id="XP_017718873.1" /db_xref="GeneID:108522926" /translation="
MERQEDSLSARPALETEGLRFLHVTVGSLLASYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAASVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSAGPSTSSVVVKRKSDRKPLRGGGYNPLSGEGGGTCSWRPGRRGRIFRGCFLTEGNTVWPCET"
misc_feature 73..621 /gene="VIMP" /note="Selenoprotein S (SelS); Region: Selenoprotein_S; pfam06936" /db_xref="CDD:462043" ORIGIN
acgtgtgcgtgggagcgcaccggaagcgtccggctggaggcgcggcggccggcctgggcggcggtggccgtcatggagcggcaagaggattccctgtccgcgcggccggccctggagaccgagggactgcgcttcctgcacgtcacggtgggctctttgctggccagctatggctggtacatcgtcttcagctgcatccttctctacgtggtctttcagaagctttccgcccggctgagagccttgaggcagaggcagctggaccgagctgcggcttccgtggaacctgatgttgttgttaaacgacaagaagctttagcagctgctcgattgaaaatgcaagaagaattaaatgcgcaagttgaaaagcataaggaaaaactgaaacagcttgaagaagaaaaaaggagacagaagattgaaatgtgggacagcatgcaagaaggaaaaagttacaaaggaaacgcaaagaagcctcaggaggaagacagtgctgggccttccacttcatctgtcgtcgtgaaacggaaatcggacagaaaaccgttgcggggaggtggttataaccctttgtctggtgaaggaggtggaacctgctcctggagacctggacgcagaggtagaatattccgtggttgcttcttgacagagggaaatacagtctggccgtgcgagacttaaaatctcttgaggagcgctctggagaatggctgaaggagaggaaacgggagccttgagcagtgtaattacaaacaaataggttgacatagtcaagactaactaagtctgtgagtctagagagacttgagttttattttgcctgtggaggaaattgggggtttcaggtcaaagagagggtcagtggaaacaagggtggaccttgtgagaggtgtggggaagtcctgggaccctcactccccttccagtgtgtaactggattggctcccaccagcacagaagatttacgacgtgggaaatggtatacttggattaaaatatttcatccagatttgtttacatctagagagaaccccttgtaggatataaggaaactttttaacattcttccttgagtatattttctgtaactgaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]