ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-07-07 07:08:25, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_009321539 1248 bp mRNA linear VRT 26-SEP-2014 DEFINITION PREDICTED: Pygoscelis adeliae VCP-interacting membrane protein (VIMP), partial mRNA. ACCESSION XM_009321539 VERSION XM_009321539.1 DBLINK BioProject: PRJNA261076 KEYWORDS RefSeq; includes ab initio. SOURCE Pygoscelis adeliae (Adelie penguin) ORGANISM Pygoscelis adeliae Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Neoaves; Aequornithes; Sphenisciformes; Spheniscidae; Pygoscelis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_008824499.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Pygoscelis adeliae Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 1% of CDS bases ##RefSeq-Attributes-END## COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..1248 /organism="Pygoscelis adeliae" /mol_type="mRNA" /isolate="BGI_AS28" /db_xref="taxon:9238" /chromosome="Unknown" /sex="male" /geo_loc_name="Antarctica" gene <1..1248 /gene="VIMP" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns" /db_xref="GeneID:103914827" CDS <1..495 /gene="VIMP" /codon_start=1 /product="selenoprotein S" /protein_id="XP_009319814.1" /db_xref="GeneID:103914827" /translation="
PVGSLLSSYGWYILLAAVAVYLLVQKISQSLAARPSSPPGAADAAVEPDMVVRRQEALAAARLRMQEELNAQAERYKEKQRQLEEEKRRQKIAMWESMQEGKSYKGNLKLNQQEVESGASTSSAVPKSKPNKKPLRGGGYNPLSGEGGGTCSWRPGRRGPSAGG"
misc_feature 4..492
/gene="VIMP"
/note="Selenoprotein S (SelS); Region: Selenoprotein_S;
pfam06936"
/db_xref="CDD:462043"
ORIGIN
ccagtgggctccctgctgtccagctatggctggtacatcctcttggccgccgtcgccgtctatctcctcgtccagaagatatcccagagcctggcggccaggccgagcagcccgccgggagcagctgacgcagctgtggaacctgacatggtggtaagaaggcaggaagctttggcagcggctcgcctcaggatgcaagaggaattgaatgcacaagcagaaagatacaaagaaaaacagagacagcttgaagaagagaagcgaaggcagaagatagcaatgtgggaaagtatgcaagaaggaaaaagctataaaggaaacctgaaactgaatcagcaggaagtagaatctggtgcctccacctcatcagcagtcccgaagtctaaaccaaacaaaaagcccttgcgaggaggtggctataaccccctgtctggagaaggaggcggaacttgttcctggagaccaggccggagaggcccgtcagcaggtggatgaggctaacctccctagtgtctcatgtcactagcaggcttgatcttacccactgtctaactgcctacagattgcatgtcacagtgactccttggggactgggcttagtgcaggtgttaacttgaaaacaggtttacaccatttccaaatagtaacgcagaagctgatactacacaagaaaaatacctgatcctcttaggatgaagaaagaaacaatttcagtgtaatcagttaattttcacccttctgtagagaggaagtgtagtctccagccaaggtgaatcacctgggattgtgagatctgggttctgtggctggctattcaaaagactggcctcaggcaaatttaattatctaggctcagtttaccgctgtaaaatgaggatatttaccatcctcaggcatgcgttaccagatttactgtgtttggctggaaggtactttagaagggaggaatattgtcatcggcagataccttgaattatagaaggagggactttcagaaaaaacagatgaactgacaaacgccaggaatttgcaccacaggccagttattgtaaagagtctctgtgacaagctaccttgaatgatgttttccttataaatggtaaacaaaccagtgaggattactgatgctagacagcagatgggggggttcttgctattctttttttttttaatttcaactgctttgtaaaaacaaaatactgttaatattaaatacaattgcaaacaaatcataaatctagtatttac
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]